CAZyme Information: ATEG_06462-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_06462-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		50887.57	4.7176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476602:588370-589796(-)

Full Sequence      

MIRPLVIFSCILVFLGLLGALSTRETVQGVFRNSWGSSDSTHQSKFPGFTIYERDDLPST
FSDACVAALTATIDCDLTVFRFGEPAYHGTLGNETLTDMVCEQSCGKSLANWFNTAEKNC
DGSTLFDHPVTIPGGNMWTGWNETCYKDPQTGQYCNDIISTFTRVARVELMPKEEMCSYC
YKTKLQMMQSSPYSYYNKVFQHNLEVVMRNCDFITSTTIPEDLALTASEDDPLCVSGKTY
TTKEGDTCTSIALEYSVSSAALYMGNQDLIRDCQQVVVGKVLCIPLSCEHTYVLQPDDTC
FSIERANGFPLFDLRVKKIITLRQLNPWINAYCTNLQSTAWAFGRVLCLSHQAGVLTETD
VVATSHNPWGTESDGYGKWMVDPSRDATLAEGTTKECWKWHTALEGESCAQICLRHKITS
TLFLAANPSLDPANCTASLTPGVTYCTAPLHGWNYTAEG

Enzyme Prediction     

No EC number prediction in ATEG_06462-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	1.66e-06	239	284	1	44	Lysin motif.
212030	LysM	2.34e-06	238	284	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	9.42e-06	240	285	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
212030	LysM	3.73e-04	399	445	1	43	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15790.1|CBM50	3.59e-151	157	456	19	318
BCS04196.1|CBM50	4.29e-130	188	456	1	269
EAA66649.1|CBM50|GH55	1.48e-119	24	454	945	1371
EAA67102.1|GH55	6.33e-108	24	458	944	1373
QGA16072.1|CBM50|CBM66	2.11e-106	34	454	6	420

PDB Hits     

ATEG_06462-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AVW3|LYSM5_ARTBC	1.45e-12	51	446	38	533	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.353479	0.646513	CS pos: 22-23. Pr: 0.5163

TMHMM  Annotations     

Start	End
5	22