CAZyme Information: ATEG_06369-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_06369-t26_1-p1
• CAZy Family: GH36
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	CH476602|CGC6	54819.92	5.9745

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476602:339257-340835(-)

Full Sequence      

MTAGTGILRVEGNKVVDDNGTEVLLRGAAIGGWMNMENFITGYPGHEKQHRAAMRKVLGP
EKYEFFFDKWLEYFFTEADAKFFAGLGLNCLRIPFNYRHFEDDMNPRVLKESGFKHLDRV
VELCAKEKIYTILDMHTAPGGQNGDWHSDNPTSYAAFWDFKDHQDRTVWLWEQIAARYKG
NPWVAGYNPLNEPCDPEHIRLPAFYDRVEKAIRAVDPDHILWLDGNTFAMEWKGFDKVLP
NCVYAMHDYASMGFPTGQRYKGTAEQNEYLERQYLRKAEFMTQNGTATWNGEFGPVYADP
RVDEDAETINQERYSLLGQQLNIYDKYNIHWSIWLYKDIGLQGMIYTNPDSPWNKTIQPV
LEKKHRLWLDNWGRRPSKEPEAVLAPMVQWIDKVCPQAKETYPTPWMTERHLLRNVFQTF
LANSFVDEFAELFRGMDHAQLEALARSFHFDQCVQREGLNEILRQHAKN

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	339	8.6e-130	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.51e-25	72	338	22	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	8.26e-16	73	337	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26442.1|GH5_22	0.0	5	467	3	465
QMW38521.1|GH5_22	0.0	5	467	3	465
UCK59003.1|GH5_22	0.0	5	467	14	476
CAP80303.1|GH5_22	6.10e-297	5	467	3	465
QBZ65040.1|GH5_22	1.22e-246	6	467	4	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.05e-20	62	364	16	341	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.61e-20	62	364	16	341	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3W0K_A	3.12e-11	82	337	30	294	Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
1EQP_A	3.30e-11	24	196	8	190	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
6ZB9_A	4.35e-11	25	281	3	261	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.48e-181	8	467	4	469	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A3DJ77|GUNC_ACET2	2.18e-20	62	364	16	341	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P23340|GUNC_CLOSF	2.18e-20	62	364	16	341	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|P0C2S3|GUNC_ACETH	5.41e-20	62	364	16	341	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|B8N151|EXGA_ASPFN	2.27e-16	17	249	25	260	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_06369-t26_1-p1.