CAZyme Information: ATEG_06200-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_06200-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		67120.45	4.4796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476601:1591663-1593507(-)

Full Sequence      

MLPSLLTWALSLWPALSQAAEINAAASAFNLSELSLGDGRFLDNQERTLSYLKFVDTERL
LLNFRANHKLDTKGAVANGGWDAPTFPFRTHVQGHFLTAWAQCYAVLGDTDCQERATYFV
SELAKCQANNEAAGFKTGYLSGFPESDFDALEAGTLNNGNVPYYNIHKTLAGLLDVWRLV
GDTTARDVLLALAGWVDTRTSALSEAQMQSVLGTEFGGMNDVLADLYHQTSDEKWLKTAQ
RFDHAAVFDPLAANEDQLNGLHANTQVPKWIGAVREYKATGDTRYLDIARNAWTITVNAH
TYAIGANSQAEHFHAPNAIAQYLDSDTAEACNSYNMLKLTRELWTLDPENTTYFDFYENA
LLNHLLGQQNPADSHGHITYFTSLNPGGNRGVGPAWGGGTWSTDYDSFWCCQGTALETNT
KLMDSIFFHSDSALYVNQFIPSVLTWSEKGVKVTQSTTFPVSDTITLDIDGNGDWELYVR
IPSWTSNAAITINGEQVTDVDVSPGSYAKIARTWASGDKVQIQLPMHLRTVPANDDPSLM
AIAYGPVILSGNYGSSSLSSAPSLALDSVVRQGDSSLDFSATANGANVTLGPFYDAQGFN
YVVYWSTTGEFGAK

Enzyme Prediction     

No EC number prediction in ATEG_06200-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	35	549	6.8e-199	0.9920477137176938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	3.21e-167	36	550	4	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	1.53e-102	30	554	8	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91894.1|GH146	3.83e-314	26	613	39	626
AWS43758.1|CBM13|GH146	1.52e-313	20	609	40	630
AVT38402.1|CBM13|GH146	5.35e-312	21	614	43	637
AVT28360.1|CBM13|GH146	2.16e-311	21	614	43	637
QLQ36379.1|CBM13|GH146	1.04e-310	21	605	47	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	7.46e-106	20	558	19	568	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.58e-101	20	558	19	568	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QJY_A	4.20e-15	278	548	289	558	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.90e-14	278	548	289	558	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.53e-12	157	526	185	579	Glycoside hydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

ATEG_06200-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000460	0.999531	CS pos: 19-20. Pr: 0.9671

TMHMM  Annotations     

There is no transmembrane helices in ATEG_06200-t26_1-p1.