CAZyme Information: ATEG_05691-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_05691-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	CH476601|CGC4	58675.84	5.5953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476601:176184-177819(+)

Full Sequence      

MANIPNLKYGLFVHLVPNRTANHDGVVVDANVLANSFDAHQFAADLVAAEVQYVVFTAWH
AKMVALWPSEKMLEWDLPNHRVDRDLVGDMIAAVRNNNIRVYLYTHPRDGMEFTAADREK
TGWGIDPPPKDEKHNPGADFNRTKWNSFVNDIYGELMQRYGQSIDGLFMDEGSPRGDSQK
VVDYPQLRSTIKAIIPHANLIQNDYGNLYGLDMGMKEYGGWDEFSQPNENLWPSYAKPVA
AIFTYTWWAANTTSSLRYSARSMFRYTVFQAATNSAGGGIAWATGPYADGGWEPGVMPTL
QQLGSWIYSIRESIFGTRPSTSYPTKPGTTIGDVSWGSATKSPDDSVEYIHVLKPPTGLT
LALPAPRDGKVFGTASLLPNSSSVVLSQDNKGVKLTIPGPWDADVTAIKVDRPEPFRPRS
SVPLCQRCEASSYSLDGMLGYIHAIQLSGTVPLYRCYSASRGDHMDTTESSCESSLYVMD
GILGYIYKARVSGSVPLYRCYSASSGDHMDTTDASCESSRYTLDGSLGYVVV

Enzyme Prediction     

EC	3.2.1.51:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	34	316	2.3e-23	0.7196531791907514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	1.23e-11	37	366	81	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	2.94e-07	37	166	84	201	Alpha-L-fucosidase.
226195	AfuC	4.91e-06	34	343	51	347	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
405546	GHL6	6.66e-04	38	170	1	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ18425.1|GH29	4.22e-200	8	470	45	479
QGQ98682.1|CBM32	1.08e-68	9	410	45	451
ADI04434.1|GH29	2.65e-12	9	411	12	416
QOG00735.1|GH29	4.97e-12	8	399	40	428
UBZ14203.1|GH29	6.32e-12	8	353	39	373

PDB Hits     

ATEG_05691-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATEG_05691-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ATEG_05691-t26_1-p1.