CAZyme Information: ATEG_05467-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_05467-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		44105.51	4.1934

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476600:1486916-1488364(+)

Full Sequence      

MRLGIALFSLIGLCHSVSALIAFPGAEGFGANAVGGRQGEIYVVTNLNDSGEGSLRDAVS
ATDRIVVFAVGGVIEISDRIVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIRI
RMGKVGDSGKDAITIAEGSTMIFDHVSVSWGRDETFSISGTASNITIQNTIIAQGLETHS
CGGLIQTGGGVSLFRNLYIDNKTRNPKVKGVNDFTNNVVYNWGGGGGYIAGDSSGDSYAN
IIGNYFISGPSTSVTAFTRGNEYFHGYVETNYYDPDRDGTLNGNELGVSASNYGGMALVD
TKYDYPAVEYQMTPGEAVNYVTGYVGASKVRDSVDTQLIAQVKSWGTKGELISDEASMGG
PGDLDGGSPPTDSDGDGIPDDAETEIGSDPNTADSMELHSSGYTYVEMWANSLVPSSYH

Enzyme Prediction     

No EC number prediction in ATEG_05467-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	71	246	1.5e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	2.13e-06	22	266	30	302	Pectate lyase [Carbohydrate transport and metabolism].
214765	Amb_all	4.67e-04	77	250	9	190	Amb_all domain.
408654	TSP3_bac	8.12e-04	372	393	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
366158	Pec_lyase_C	0.002	78	220	28	190	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91803.1|PL1_2	7.00e-248	7	419	8	420
QMW43898.1|PL1_2	2.04e-242	1	418	1	418
QRD90936.1|PL1_2	5.85e-242	1	418	1	418
QMW31873.1|PL1_2	5.85e-242	1	418	1	418
EAA62493.1|PL1_2	4.23e-240	7	418	7	415

PDB Hits     

ATEG_05467-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CLG7|PLYC_ASPTN	7.54e-307	1	419	1	419	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|A1DPF0|PLYC_NEOFI	6.78e-253	7	419	8	420	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	3.91e-252	7	419	8	420	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|B0XMA2|PLYC_ASPFC	1.59e-251	7	419	8	420	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	1.04e-242	1	418	1	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000371	0.999611	CS pos: 19-20. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in ATEG_05467-t26_1-p1.