CAZyme Information: ATEG_05456-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_05456-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		64533.21	5.7461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476600:1463359-1465101(-)

Full Sequence      

MSVQDSARFDFIVVGGGTAGNVVAGRLAESPEVSILVVEAGVANSKDLEEIRTPSNAMEL
RGSQYDWAYKTTIVKRDDYERVEKPNTRGKALGGSSCLNYFSWVPGSKGTFDMWEEYGGT
EWTWDMLVPYLRKSATYYDDDKVYSPDLIKIGTGGPIPIAHSELIPEMQPFRDLLTRAWK
STGQPITENIFDGEMIGLTYSVNSIYKGRRSGSFLCVADKPNITILSQAHSKNLIVDAGD
KTCKGVTVITSSGQELNLFATREVVVSQGVFETPKLLMLSGIGPADELSRHNIPVILDSP
HVGQHLLDHPGVPFVLRVKDGFGMDDYVLRHGTPQNKQAIQAYQDQHRGPLGSGFLEMIG
FPRIDSYLEKSPEYRKAKASNDNKDPFCPYGQPHFELDFVCLFGSAFQWHYPTPRKGSYI
TVMVDLVRPVSEPGEVTLNSADPLQQPNINLNYFNNDLDIIALREGIRFAYDVLKNGDGF
RDIFVDEYPWEMPLHDDKLMKQAVLDRSQTSFHPCGTARLSKHIGQGVVDPGLKVHGIKN
LRVIDASVIPVIPDCRIQNSVYMVGEKGADAIKCDHKDLY

Enzyme Prediction     

No EC number prediction in ATEG_05456-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	573	8.5e-147	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.52e-85	9	577	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.63e-74	8	573	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	7.38e-41	429	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.06e-29	2	565	50	569	Protein HOTHEAD
366272	GMC_oxred_N	1.13e-19	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90169.1|AA3_2	0.0	1	580	1	580
QKX59780.1|AA3_2	0.0	1	580	1	579
QLI67929.1|AA3_2	0.0	1	580	1	579
QKD59313.1|AA3_2	0.0	1	580	1	579
QGI68848.1|AA3_2	0.0	1	580	1	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU3_A	0.0	5	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	0.0	5	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	5	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.30e-70	9	575	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.57e-70	7	575	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	9.15e-58	1	573	28	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.68e-56	9	572	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	4.05e-56	3	575	45	623	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|B1Z034|BETA_BURA4	9.63e-56	8	573	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q39A44|BETA_BURL3	1.85e-55	8	573	5	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000010

TMHMM  Annotations     

There is no transmembrane helices in ATEG_05456-t26_1-p1.