CAZyme Information: ATEG_05379-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_05379-t26_1-p1
• CAZy Family: PL9
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	CH476600|CGC12	95643.36	6.0823

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476600:1268743-1271395(-)

Full Sequence      

MKTTGIEFPEQPWEAQIWHNIASEEWTALPLRKCQNVTPLLSGNDAEHRYYRHVFSEQLI
LPPNGGYGQFTVRFRTCPTADWQWVNQIQQSNDGQIVFPPRTPVVESNTDVLSRYFSNLS
HDVEVQPRKSEAPGSALWHISGETQSADGKEPGLRDVVLGIPTSLVRYFALVRIWTPWLG
PRHGRQKFRLAEDAILCSFLRTDGVHVVLLAISGIDNVLTVLGSGENGEVIVKTKSDSDQ
PSNFQVLASAADSFDVAMSAVVYEARKAVRPYGADEPERVPTPVSPLGDDVVLVEKDPEA
QWLSEWYDALTYCTWNGLGQDLNEDKILRALDTLEKNGIQIANLIIDDNWQSLDHEKEVQ
FKRAWQRFEANKHGFPYGLKHTVENIRRKYPKIAHIGVWHAMFGYWGGISHTGELATQYK
TKEIDIVNPCAGGPIAHAFEKGSLLIIDPEDVQRFYDDFYDFLRSIGIDAVKADAQFFLD
LVKNADDRRDIINAYQDAFSISSLRHFGTKTLSCMSQFPQAIFHSQLPTNKPTILLRNSD
DFFPEVPASHPWHIFCNAHNALLTRHLNVLPDWDMFQTSHPYASFHAAARCVSGGPIYIT
DEPGKHDLALIDSITAPTTNGRTVILRPGLVGRTIDTYHDYNEGHMLRVGTYCGWAQTGS
GILGLFNLSSSSISSIISLLDFPGIHEDYTGKYLVRAYTRGKVTEPMRPGDDNSTVAVNL
DHKGWEILTTYPLHTRTMKGDKECSVAILGLLGKMTGAAAIVNSDIQVEPNGRLRCDISL
KALGTLGVYFSLLPEWSVEVNFMVMILGRPVPRKTVKKDGGSDTTILAVDVLTAWREMRL
NPGWSNEVIVQIFVG

Enzyme Prediction     

No EC number prediction in ATEG_05379-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
283371	Raffinose_syn	8.08e-52	308	794	199	724	Raffinose synthase or seed imbibition protein Sip1. This family consists of several raffinose synthase proteins, also known as seed imbibition (Sip1) proteins. Raffinose (O-alpha- D-galactopyranosyl- (1-->6)- O-alpha- D-glucopyranosyl-(1<-->2)- O-beta- D-fructofuranoside) is a widespread oligosaccharide in plant seeds and other tissues. Raffinose synthase (EC:2.4.1.82) is the key enzyme that channels sucrose into the raffinose oligosaccharide pathway. Raffinose family oligosaccharides (RFOs) are ubiquitous in plant seeds and are thought to play critical roles in the acquisition of tolerance to desiccation and seed longevity. Raffinose synthases are alkaline alpha-galactosidases and are solely responsible for RFO breakdown in germinating maize seeds, whereas acidic galactosidases appear to have other functions. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36C.
166325	PLN02684	3.71e-48	308	633	202	536	Probable galactinol--sucrose galactosyltransferase
215203	PLN02355	9.11e-48	205	795	120	718	probable galactinol--sucrose galactosyltransferase 1
165863	PLN02219	1.07e-47	299	633	190	537	probable galactinol--sucrose galactosyltransferase 2
215381	PLN02711	6.08e-36	222	667	146	599	Probable galactinol--sucrose galactosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW41568.1|GH36	0.0	9	855	79	945
QRD85862.1|GH36	0.0	9	855	79	945
QMW29496.1|GH36	0.0	9	855	79	945
UDD58548.1|GH36	0.0	9	855	47	913
BAE59249.1|GH36	0.0	9	851	47	909

PDB Hits     

ATEG_05379-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q84VX0|RFS1_ARATH	1.98e-45	312	801	202	720	Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=RFS1 PE=2 SV=1
sp|Q94A08|RFS2_ARATH	5.98e-43	299	767	189	683	Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=RFS2 PE=2 SV=2
sp|Q8RX87|RFS6_ARATH	1.24e-41	308	795	204	708	Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana OX=3702 GN=RFS6 PE=2 SV=2
sp|Q9FND9|RFS5_ARATH	4.10e-33	308	617	222	561	Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=RFS5 PE=1 SV=1
sp|Q8VWN6|RFS_PEA	1.26e-31	163	791	111	757	Galactinol--sucrose galactosyltransferase OS=Pisum sativum OX=3888 GN=RFS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000056

TMHMM  Annotations     

There is no transmembrane helices in ATEG_05379-t26_1-p1.