CAZyme Information: ATEG_05089-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_05089-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	CH476600|CGC14	87310.10	6.1696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476600:460347-462843(-)

Full Sequence      

MRLKHLLLAGALQATFGYALLAPRIYRDHHGTPHAVHNGTTYTLSSDGTSPSVLILDYGR
DVEGYGTFHVSRRSGNTSVFEMSYSETNALLDTYMADGPLPLAAAMDTYRINRYNITEEK
TYENRLIQGALRYQKLNLSSAGELELSFVGFRPAVHEVPLSQLPGSFNCSDPMLNRIWET
GARTVQLNEFPARSLPDFWVVTDEGALVDSLAPQPFAADFAAALTAYTVAFSVKPVVRGF
GATVLSDTLGNGVYIFVDVANSSISAHAGSTEMGGPPLASAVLPPTVALNQWHTVEATVN
ATRINIQIDGTPVLDFSQTAAFYGSFGLGASFGHTAVFTNVSLTAFGTQMYSSSLTDRSA
LEDFLLGTNPLPVSVDGSRRDRIAYAGDLDITARTAFASTNGLEYINGSIALLGSMQMLP
GFFTPTAKVQQAPRTEPIQANITGLIGYSFSLASAMAQYYEQTGDASFLRNWAPRVSRLF
DWADSQTLPNGLLNISDATFGGDWNYYDPPLSGVVSKFNLIYAHALKQWLPYMADGRLNA
TTYANRLHSLQHAISTHLWSDELQAFYLADAHRDFFSQEANALAILTDTVPVAGNRSART
VLSTMARDLYVPAGALAFSNASAASGWAQKISPYAAGYHLQAAFHAHDAANAERLLRSVW
GPMSDPSHANYTGCTWETLDADGTPGLGASTSLCHAWGSAPTGALSRYVLGVRAVTPGFQ
EWTVAPQTLGLEYARGRYPVPGGSIQVDWSFGRDGMLNMTVIAPAGTKGTVVPPSPLKVP
LSKYRGTGYVEKVDGGFVVQGGQVFTLQQSR

Enzyme Prediction     

No EC number prediction in ATEG_05089-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	370	771	2.1e-68	0.7301587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	1.06e-10	711	774	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	5.68e-09	459	709	110	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
404293	Laminin_G_3	2.92e-05	227	339	19	132	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
238058	LamG	0.003	284	319	74	109	Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules.
395008	Laminin_G_1	0.008	279	318	42	81	Laminin G domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD63660.1|GH78	0.0	4	810	218	1030
QMW46762.1|GH78	0.0	4	810	5	817
QMW34696.1|GH78	0.0	4	810	5	817
QRD93478.1|GH78	0.0	27	810	232	1013
CAK96693.1|GH78	0.0	10	810	17	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.37e-14	375	747	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

ATEG_05089-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001475	0.998519	CS pos: 19-20. Pr: 0.9448

TMHMM  Annotations     

There is no transmembrane helices in ATEG_05089-t26_1-p1.