CAZyme Information: ATEG_04852-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_04852-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	CH476599|CGC3	67077.00	7.1472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476599:1708876-1710852(-)

Full Sequence      

MAGPASQLAANAICSLEEFRRVSYDYIIVGGGTAGLTLAARLSEDPNVNVGVLEAGKDQT
KNELVRTPALFPQMLTNPEYDWLMYTVPQKGNHNKIHHQTRGKMLGGCSATNGMMYVRGS
KQDFDDWGAFGKGWSWSSIAPYFRKHERMDDTRVGLPGDNKFLQFQKKSHGQHGPIETSF
NNWRNPLERYFLQAAKEASGMTASPVDPWGGDHLGFFSSLATVDRRGDKGTRSYAATGYL
LPNLTRPNLKVLTEALAVCVTLEGTSASGVRFMHAGTTYDVRAAREVIISGGVYKSPQVL
ELSGIGDPSVLKAAGVQCKVPLPGVGANLQDHVLSGAVYELKDGVMSFDALRYPSVAQEH
MDMYAKDRTGILAAATSCMGFLPYSSLVSKDELEATCQKILSLPAETAFQQNQREQIVSH
LRSPSSANIQYILSQGTVDLENAPSDQSKFAKALSPEDPNGFTIVTCLQYPSSRGTVHIT
SSDPHQNPAIDPAYLTNPADVDILAAGLEFCDKIAGAPGLKDKVVRRALPSPSVSLQSRT
QAAEAVRENCMTEYHPCGTCAIGQVVDERLRVLGVKRLRVVDASVFPGNVSGNILSSVYA
VAEKAADMIKEDAKHVRASL

Enzyme Prediction     

No EC number prediction in ATEG_04852-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	612	5.3e-178	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.63e-124	23	610	5	532	choline dehydrogenase; Validated
225186	BetA	3.18e-117	23	614	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.46e-40	471	605	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.33e-29	101	332	23	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.27e-17	5	588	37	558	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29957.1|AA3_2	7.55e-304	5	620	3	618
UJO21990.1|AA3_2	2.40e-191	11	612	10	613
SMQ52591.1|AA3_2	1.56e-190	24	612	37	629
SMR55413.1|AA3_2	1.56e-190	24	612	37	629
SMR57790.1|AA3_2	1.56e-190	24	612	37	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.55e-69	24	612	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.30e-69	24	612	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	3.53e-67	23	614	5	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	4.07e-61	23	612	5	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3Q9T_A	1.45e-59	24	614	7	574	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.12e-163	12	612	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.12e-163	12	612	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	6.16e-163	15	612	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	9.12e-90	6	612	22	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	9.72e-89	23	609	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000002

TMHMM  Annotations     

There is no transmembrane helices in ATEG_04852-t26_1-p1.