CAZyme Information: ATEG_04823-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_04823-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: protein EPD1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	CH476599|CGC8	56720.03	4.4542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476599:1635254-1637043(-)

Full Sequence      

MKLSLAVGASLLGSALAIDPIVIKGSKFFYSSNNTQFYIRGVAYQQDYSSNGTTSGSNSY
KDPLADATACERDVPILQELNTNTIRVYAVDPTANHDKCMQLLADAGIYVISDLSDPSQA
IDRSDPRWEVSLYERYTSVIDDLSQYNNTIGFFAGNEVSNTVSTTDASAFVKAAVRDMKA
YIKEKGYRSMGVGYATNDDSTIRVNMADYFNCQNSEDSIDFWGYNIYSWCGDSSYQASGY
KERTEEFRNYSVPVFFAEYGCNEVTPRKFTEIKALFGDKMNDVWSGGIVYMYFQETNNYG
LVSVVDSTSVSKMADFTYYSSEIASATPTGTNKASYTPTNTALQSCPAVTSDWRAKATPL
PPTPNEELCDCMVAAAGCVVKDSISSSKYSDLFSTVCGMTECDGVLANGTTGVYGAYGMC
NAKAQLNFLLNKYYTEHSSQASACSFGGSATTTSTTKPTGTCSSLMKEAGTAGTGTVTSK
PTGTGSGAAASSSSSSGVGVPLAGSTMVTVGSFQLGAYAVTAVVAALGMVLL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	17	325	6.4e-139	0.9839743589743589
CBM43	378	463	2.4e-20	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.99e-163	20	326	11	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.24e-27	378	450	3	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	4.90e-14	378	450	3	71	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE66482.1|CBM43|GH72	9.51e-298	1	532	1	531
QMW48313.1|CBM43|GH72	7.79e-297	1	532	1	531
QRD92751.1|CBM43|GH72	1.11e-296	1	532	1	531
QMW36259.1|CBM43|GH72	1.11e-296	1	532	1	531
UDD65514.1|CBM43|GH72	1.11e-296	1	532	1	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	2.17e-125	21	434	36	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	6.13e-125	21	434	36	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	6.13e-125	21	434	36	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	2.42e-201	4	532	5	545	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|B0XVI5|GEL4_ASPFC	6.20e-190	6	532	7	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	6.20e-190	6	532	7	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	3.09e-189	1	481	1	480	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	3.42e-189	1	481	1	480	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000403	0.999540	CS pos: 17-18. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in ATEG_04823-t26_1-p1.