CAZyme Information: ATEG_04069-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_04069-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1421	CH476598|CGC13	158101.88	6.3845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476598:1463201-1468088(+)

Full Sequence      

MPETFDVEHVLANISEQDKIALLSGTRTQLTLAPHSLTALGIDFWHTHPIPEFNVPSIRT
TDGPNGIRGTKFFGGIPAACLPCGTALGATWDRDLIYQAGKLLGDECIAKGAHCWLGPTI
NMQRAPIGGRGFESFAEDPHLSGILAKSIILGCESKGVISTVKHFVGNDQEHERRAVDVL
VTQRALREIYLRPFQIVARDAKPGALMTSYNKINGKHVVEDARMLNLVRDEWKWNPLVMS
DWYGTYTTIDSMNAGLDLEMPGVSRYRGKYIESAVQARLIKQSTIDARARKVLEFVKQAS
QVQVSEVERGRDFPEDRALNRKVCANSIVLLKNEDILPLPKDVKKIALIGSHMKTPAISG
GGSASLEPYYSVSLYDACTEALPNAEVLYEAGAYAHKMLPVIDRLLSNAVIHFYNEPMGK
ERHLISTEPVSTTAFQFMDYYAPGLNRGLFWATLIGDFTPDASGLWDFGLSVFGTANLYI
DDELVIDNTTNQTRGTAFFGKGTVEELGSKELVAGTTYKIRIEFGSANTTTMKTVGMVNF
GGGAANLGACLRMDRDEMIENAVKAAAEADYTILCTGLNRDWESEGFDRTHMDLPPGVDR
LISKVLKAAADKTVIVNQSGTPVTMPWADQARCIVQAWYGGNETGHGIADVLFGEVNPCG
KLPLSWPVDVKHNPAYLNYASVGGRVLYGEDIYAGYRFYEKTGREVLFPFGHGLSYTTFK
VSPSVTVTPEIFNMGRPPVATVQIKNTGKLAGAQILQLYISAPESPTPRPNKELHGFEKV
FLQAGEEKTVEIQLDRYATSFWDEIEDMWKSEQGTHRTPSPIPGIVVFSLVLACHHRVFL
RLSPVSPAGSPSRKNARFFDSATSQAHAGAHRVRCLSSQQDSMRLGPAKTWGARILDAVE
RQERLLSESLATTRGPPLAPQQASPSPVDEVDPESISRNDALKTPITGSDMILSWPIFPR
EKPVSTFPMVAYSEKPDRFQTALPSLDPQRLLELREIFMTKIWTKNPIVDPDQLDLYIAR
VLENGIDWSASSCLVLLVFALAAIWGNYPDDETREVSYNEPSFTPPVTYVTMSVPEHRMK
ESLAFLAMARKRISAAYLDDTLLGVQCLCLFGIWYQYNIEPIPGWKMFRTASMLWQTYHL
KHREGKTIRNAQEENSEVRYELTDLPPCDLSLSDFPYSLPSFPTRQPSNDSPGRLFSNPS
ATDLEAASSYYYLAEISLRRLLNRARNAVRVLSPDIDLPTIKVLADTLTQLEGQLQQWVD
CLPHTLRFNMPLESAPRQNEGELMKLARERYVEVRELLCRAYLYLCIHVPLDPALAALYG
VKASEALLLAVYRIQTEVPFFRHPGSWGACRVRFNHALCLIAGFRAKMKQLPSAEYVSIP
PAWADCVRVVIERLKIWGEEGGGLKELSVLLEWLLHGSMEA

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	50	261	4.7e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.63e-78	82	803	121	734	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	6.06e-59	328	716	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.69e-54	43	352	48	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.63e-33	81	294	88	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.06e-28	61	795	96	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP92979.1|GH3	0.0	1	816	1	800
BCS24030.1|GH3	0.0	1	816	1	802
QMW31983.1|GH3	0.0	6	816	4	806
QMW44017.1|GH3	0.0	6	816	4	806
UDD60961.1|GH3	0.0	6	816	4	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.11e-219	5	816	4	817	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.55e-214	5	816	4	817	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.07e-128	29	814	11	647	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.36e-97	30	816	12	644	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.54e-89	50	814	87	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U9M7|BGLH_ASPOR	0.0	6	816	4	799	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B0XM94|BGLH_ASPFC	0.0	1	817	1	802	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|B8NPL7|BGLH_ASPFN	0.0	6	816	4	799	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1
sp|A1CUR8|BGLH_ASPCL	0.0	1	817	1	802	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	0.0	1	817	1	802	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ATEG_04069-t26_1-p1.