CAZyme Information: ATEG_03785-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_03785-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
916	CH476598|CGC9	99764.21	5.4837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476598:633731-636829(-)

Full Sequence      

MARTNNANMAPSHRDRSWSPKATNINYFIQDPIPSRYGSENSQSRNSRQREGHQVQDPKA
RPTLGHQPLHNLVDNLLDDGDSLIDELLGLLGHQDEDNEATSSPDPEIKPTTRHTVPVTR
PATKTTEPPKPEPSKETEAPKPTATAKPTSSSENSEAPPDCSESNSIPQTSHPEPTKPAT
TPSHPNQSEGGPTAAMANQDVFLPVATGPIPQTVTSRDDHPVPKKNVLSDKPIETNKFYA
GLFLGTQTNASFTFPYSIAWSKGTGDLQSWGMGISHVEADKIAFGPINDNIPGDPVQYYV
NPIGIQSIILSAQELGKQTVLNVENPLPFSANAVLQPQEGSRERITIPVLQGMGFVTGIY
SGLQPNVESAVGYKKVVTAGSPRPGVFKYTASLLDGTTWLIYYTPTDGQDPEPRLESAHL
LRGPLGWSGTIQVAKNPAGVSGEKMYDNSSGVYAVQGAVSGAVSGRTGTYQIQWAKDGKD
AESTPLMMFALPHHLESFDTATQGRATNITLRTTTKGTAAAVIGETWTLVEPDLPIDMGF
APWSVSGGSITQLSARAQKVLTDVAPTELQQDVDQQTDLNSMYYSGKAFSKIATLVYTVD
KLGGNPQMAASTFSALKTAFAKFVSNKQQFPLVYDNVWKGVVSSASYNGGDSGADFGNTL
YNDHHFHYGYFIHAAAIIGSLDPSWLPENKDWVNMLIRDAGNSVSDDPLFPFSRGFDWYH
GHSWAKGLFESYDGKDEESTSEDAMFAYALKMWGKTIGDASLEARGNLMLGILRRSLHNY
FLMEKDNKNHPAKFVPNKVTGILFENKVDHTTYFGANLEYVHGIHMLPLLPSSAYVRNKN
FVQEEWEAMFAPQAADPAEKVQGGWKGVLYANLAIINPEASWEFFAQSGFNYSWIDQGAT
RTWYLAYAAGLGGAPS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	219	907	6.3e-225	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	553	905	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	202	916	56	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	6.01e-153	220	544	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
411408	PspC_subgroup_2	2.15e-06	71	237	259	432	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
411408	PspC_subgroup_2	5.93e-06	103	187	404	501	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82801.1|GH81	0.0	194	914	188	910
QMW28320.1|GH81	0.0	194	914	188	910
QMW40391.1|GH81	0.0	194	914	188	910
UDD56325.1|GH81	0.0	194	914	2	724
BAE58039.1|GH81	0.0	194	910	2	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.88e-98	200	909	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.72e-97	200	909	32	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.66e-95	200	909	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.06e-28	583	888	340	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	3.35e-24	583	898	361	671	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.46e-317	170	910	163	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.47e-173	200	915	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.45e-162	211	911	411	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.16e-161	220	911	66	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	3.41e-159	193	910	420	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_03785-t26_1-p1.