CAZyme Information: ATEG_03640-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_03640-t26_1-p1
• CAZy Family: GH154
• CAZyme Description: cutinase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220		23019.70	6.6810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476598:201574-202357(-)

Full Sequence      

MVALHTLLLTAFAAVSLANPIPAPELEARQIINANDLENGVCKPVVLIFARGSTELGNMG
AIAGMPTCNALKLALGSQNVACQGVGGAYTASLIPNFLPANTNQASIREATGVFEMAHTR
CPNSQIVAGGYSQGSAVMDNTIQDLPDVIKNKVKGVVLFGFTRNLQDLGRIPNYPKEQTK
VICAVGDLVCVGTLIITPAHLTYTLNAPEAAQFLASMVSV

Enzyme Prediction     

EC	3.1.1.74:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	42	217	5.6e-39	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.07e-56	42	216	2	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UBX54567.1|CE5	2.11e-140	1	220	1	220
UDD63915.1|CE5	2.47e-96	1	218	1	221
QRD91206.1|CE5	3.50e-96	1	218	1	221
QMW34880.1|CE5	3.50e-96	1	218	1	221
QMW46952.1|CE5	7.06e-96	1	218	1	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	3.11e-70	25	218	4	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	6.92e-67	31	218	1	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	5.84e-66	26	219	5	199	Chain A, cutinase [Malbranchea cinnamomea]
4OYY_A	6.58e-64	35	218	7	192	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1CUV_A	1.01e-62	22	218	6	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CRP4|CUTI5_ASPTN	2.13e-156	1	220	1	220	Probable cutinase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_03640 PE=3 SV=1
sp|Q0CW01|CUTI4_ASPTN	3.18e-112	4	219	3	218	Probable cutinase 4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_02133 PE=3 SV=1
sp|Q0CNE3|CUTI3_ASPTN	2.17e-98	4	218	3	217	Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_04791 PE=3 SV=2
sp|B8NCM8|CUTI3_ASPFN	6.22e-97	1	218	1	221	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	7.22e-96	1	218	1	221	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999737	CS pos: 29-30. Pr: 0.8215

TMHMM  Annotations     

There is no transmembrane helices in ATEG_03640-t26_1-p1.