CAZyme Information: ATEG_02886-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_02886-t26_1-p1
• CAZy Family: GH105
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	CH476597|CGC17	43399.91	5.3000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476597:288960-290279(+)

Full Sequence      

MILKGPRKPGLTRILGLALFVCAIIYLLWPEVDARYWDRNVPRSNGDSLHDDILSHTQNE
TLGFEHIYAIGLKERTDKRDFLTLASLEAGFKVDWLDGVRVDSLDPKSLPNGANFSWIKP
TAVACWRAHMNAMQKVLQNSYSTALILEDDADWDISIKHQLREFARGVRQLNGEEHAPKE
TPYGLDWDILWIGGCASGPSANETTFFAIPDDPTVPSKEHLDTWGGPLEKWKEQYPELSD
DSTRFIYQASMGCCTYGYAVTAKGAKKILAALSLDRLDCPVDNAMSDLCAGTNGRRQVKC
FAPWPNLIGTYKHAGPESRDSDIEDRSEDKFHDASSMNVVYSTRLNIQRLIGQEGKVYSQ
HKDNRTDAVRELDLSEIDYPRGFLVG

Enzyme Prediction     

No EC number prediction in ATEG_02886-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	64	285	6.5e-33	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	2.67e-18	66	154	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	3.50e-07	64	285	1	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	4.42e-05	63	288	1	190	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK45731.1|GT25	1.65e-161	7	385	4	385
CAP98036.1|GT25	4.01e-158	35	385	32	388
BCS10899.1|GT25	6.06e-152	8	385	5	375
BCR98565.1|GT25	2.58e-151	8	385	47	417
CAK38229.1|GT25	2.03e-147	8	385	317	687

PDB Hits     

ATEG_02886-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PK45|GT251_BOVIN	2.95e-10	60	324	337	573	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q8NBJ5|GT251_HUMAN	1.62e-09	60	324	336	572	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|Q8IYK4|GT252_HUMAN	4.65e-07	60	324	337	573	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
sp|Q6NVG7|GT252_MOUSE	8.16e-07	60	324	336	572	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.593473	0.406538

TMHMM  Annotations     

Start	End
13	30