CAZyme Information: ATEG_02724-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_02724-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	CH476596|CGC4	79502.09	5.0936

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476596:2330497-2332677(+)

Full Sequence      

MTHLAEYTFHDAIAAVKSGEPLAQVTQKLLSQLTTDERLALLDGDVEFWPGLGSILRDRY
NRTPYVHGAVPRLRIPGIKFTDGPRGVVMGNSTAFPVSMARGATWDLELERRIGDAIGLE
AKAQGANYFAGVCVNLPRHPAWGRIQETYSEDPLLLGEFGLALTQSVQNHVMACVKHYAL
NSMENARFRVDVSIDESVLHEVYLAHFRRIVEGGAAAVMSAYNSVNGEWAGQNKHLLTEI
LREQWGFDGLVMSDFIFGLRDAAKSVRNGLDIEAPFRQQRAMHLGTSLERGDLSWDDIDR
SCERILRKELEFAVKTENSQPGADVIFCDKHRALAREAAARSMVLLKNDAVDGSPILPLN
AASLSRVAVVGRLANIANTGDKGSSQVFPPNVVTPLDGIRASLPGVEVLFADSQKEAETL
ATQVDAVICIVGYTHEDEGEYVIPALLENPDLQKVLPPPRNDEERKTLAILQGKLNPGSE
GGVEAGAGGDRVSLRLREEDENLIAAVAARNPRTVVSIITAGAVIVESWKNKVPAIMMSW
YSGSEGGHALADVLLGKTDASGRLPFSIPTEEAHLPFFDRDASEISYDRWFGQHLLDKLG
VRAAFPFGCGLSYTTFIVSEVTVRKEDSEHIDVQFVVRNTGERDGRFIAQVYGLPGCEDF
PTRLLLGFTPVDLEAGQTLKCQVSASLRPLQQWKDGKWSLRTHELDVEVARFAGDEDAAT
ARAVLC

Enzyme Prediction     

No EC number prediction in ATEG_02724-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	274	3.9e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.30e-58	72	678	101	718	beta-glucosidase BglX.
224389	BglX	1.97e-57	69	401	54	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.26e-46	21	684	48	741	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	4.67e-44	343	613	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.21e-38	72	307	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC95327.1|GH3	0.0	1	725	1	725
BAE55411.1|GH3	0.0	6	718	6	718
UCK59088.1|GH3	0.0	6	718	6	718
QMW26514.1|GH3	0.0	6	718	6	718
QMW38593.1|GH3	0.0	6	718	6	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	9.40e-75	28	709	6	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.27e-74	27	715	6	659	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X42_A	1.28e-73	28	709	6	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.05e-71	75	715	37	654	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	7.32e-67	28	693	56	795	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	6.51e-74	27	715	6	659	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|A7LXS8|BGH3A_BACO1	1.08e-73	45	695	43	714	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.18e-70	29	715	5	787	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|F6C6C1|APY_BIFBA	4.07e-69	75	715	37	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	5.85e-69	27	715	12	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_02724-t26_1-p1.