CAZyme Information: ATEG_02130-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_02130-t26_1-p1
• CAZy Family: CE16
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	CH476596|CGC5	35995.39	5.8964

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476596:688472-689945(-)

Full Sequence      

MCRLAVNFGPHTSENVLVAYRIGGLDWEFSNVTANATYQFVGPWTTALNTTQNSDTKAFE
MRVQIGGIFVHKDAQLVKPPEFNKTVEIIGDSLAAGQYATYEGLASWAFNFAAGLGNVEY
SITAYPGICLVDQKCYGGTARGMTHQWLQIPDVGARANATYGNRSVPWDPTARRAADLVV
INLGTNDSRDPNNIPGGEFYNAYVGLVDEIHRVWPATQIILMGLWGEFEATGNTYVQKPL
YVSDIQRVYQHFEGHGFVHYFDTKGILQHNDIAPRDHPTDVGHLKIASHLLQWVKIKLGW
ELGATGPEVQHDTLYWNNEEAYK

Enzyme Prediction     

No EC number prediction in ATEG_02130-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	87	293	2.4e-21	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.25e-52	86	295	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	4.38e-15	86	292	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	6.49e-14	88	283	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	4.38e-06	159	292	44	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.90e-05	174	290	77	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34907.1|CE0	1.80e-173	3	323	79	399
QMW46983.1|CE0	1.80e-173	3	323	79	399
QRD91240.1|CE0	1.80e-173	3	323	79	399
BCS11519.1|CE0	2.46e-168	3	323	52	369
UDD63953.1|CE0	1.09e-160	7	323	44	366

PDB Hits     

ATEG_02130-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATEG_02130-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995565	0.004440

TMHMM  Annotations     

There is no transmembrane helices in ATEG_02130-t26_1-p1.