CAZyme Information: ATEG_01862-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01862-t26_1-p1
• CAZy Family: CBM66|CBM66
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1352	CH476595|CGC15	149721.95	5.9006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:2464238-2468740(+)

Full Sequence      

MRSGCWDSQMCDLRSTWMMSWVLFLSLWLALAQGMKTDQIKGLRKETEQMFYHGFENYIK
YAYPEDELRPLSCRPLSRDRENPAHAELNDVLGNYSLTLIDSLSSLAILSSADDGGRALG
HFQDGIKDFVRLYGDGSSGPAGQGERARGFDIDSKVQVFETVIRGLGGLLSAHLFAVGDL
PITGYSPPETEAAFAKAWDKTSFPKDSHGIEWENGFVYDGQFLRLATDLANRLLPAFYTD
TGLPYPRVNLRYGVQRHPFYANSPLNTARACDGPSHASCQKPRRSSLQETTETCSAGAGS
LVLEFTVLSRLTGDGRYEELAKRAFWAVWSRRSEIGLIGSGIDAESGRWVHSYTGIGAGI
DSFFEYAFKSYVLLSSGERPPYDTESPWRALDDYFLPLSEYEHSPEAFLQVWEESHASIK
RHLYRGEGYQHPHLIQGDIFTGATRAFWIDSLSAFYPGLLTLAGELDEAIGIHLLTTAVW
TRFSGLPERWNVATGNIEGGLAWYGGRPEFVESTYYLYRATKDPWYLHVGEMVLRDLKRR
CWTKCGWAGLQDVRNGELSDRMESFFLGETAKYLFLLYHPEHPLNKMDQPFVFSTEGHPL
IIPKSTFGSEAPRNEQTPVFGAARESVCQTAPVPPTFGLSSTAARPDVFHAASLARLHLM
PNRGPAEGPLLDYAKDHPSVSVSDLSSPTNYTFFPWTLPPELIPFNATSSPMNVRPTLDI
SFPSLPGMVLGSGSLERVRDGVLVKAIGGLRLSMIQDVPSQGVSEQSNGEEYRVQVINNV
PLGKDEKVYLSREITFDVLDPSDPNFTRIRDSAMVDLVIDVLPETVRRGNDSDDLEESAT
AAEPLVRGSKHLADDHKLGPVDPSPSGMRTVLSSVMQSLSALLRDEIQGSSGKPRPLRLA
LPASTASGLGSGPMPEVEDATTFSVTGDVSKNRLAWSTIYFADDLCDDRIPREVVQNHQV
LVLKRGGCNFSQKLRNIAAYPPSRHALKLVIVVSDEEPTDEQTAGVDTPSPAPPGFAALR
AAPYLARPHLDEPQLTAGGIARRHLIPMVMVGGGDETYALLQRAVGVGIKRRYTVRSQGV
PISNLHLLPTPKQKLPTSHKTIPQSNSTTMHPQDTSAAAKTTITITTTDLIDPSPSTTRA
RALYFAYGSNLSFTQMRHRCTQNPHLSARPVALARLDHWRWLICQPGYANVVPPPHLRIG
PQARDGDAVPVSGAEDAVFGVLYEMDAADERLLDGYEGVDHEAPLVDPGSRDCPVPWSVR
PREQGRGDYNKWYVPATVVQWLDEAQRVRWEGSSGEGMVPTLVYVDELRVRSAPPKEEYV
PRMNRAIREAETLGFPKGWADEVMRKWIPLEN

Enzyme Prediction     

No EC number prediction in ATEG_01862-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	50	601	1.2e-142	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.79e-130	50	602	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.00e-60	44	604	73	520	glycoside hydrolase family 47 protein; Provisional
119400	GGCT_like	6.61e-10	1144	1242	1	76	GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) catalyzes the formation of pyroglutamic acid (5-oxoproline) from dipeptides containing gamma-glutamyl, and is a dimeric protein. In Homo sapiens, the protein is encoded by the gene C7orf24, and the enzyme participates in the gamma-glutamyl cycle. Hereditary defects in the gamma-glutamyl cycle have been described for some of the genes involved, but not for C7orf24. The synthesis and metabolism of glutathione (L-gamma-glutamyl-L-cysteinylglycine) ties the gamma-glutamyl cycle to numerous cellular processes; glutathione acts as a ubiquitous reducing agent in reductive mechanisms involved in protein and DNA synthesis, transport processes, enzyme activity, and metabolism. AIG2 (avrRpt2-induced gene) is an Arabidopsis protein that exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae pv maculicola strain ES4326 carrying avrRpt2. avrRpt2 is an avirulence gene that can convert virulent strains of P. syringae to avirulence on Arabidopsis thaliana, soybean, and bean. The family also includes bacterial tellurite-resistance proteins (trgB); tellurium (Te) compounds are used in industrial processes and had been used as antimicrobial agents in the past. Some members have been described proteins involved in cation transport (chaC).
238300	PA	0.001	959	1013	48	97	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.
399234	GGACT	0.001	1144	1242	1	76	Gamma-glutamyl cyclotransferase, AIG2-like. GGACT, gamma-glutamylamine cyclotransferase, is a ubiquitous enzyme found in bacteria, plants, and metazoans from Dictyostelium through to humans. It converts gamma-glutamylamines to free amines and 5-oxoproline.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61917.1|GH47	0.0	1	1351	254	1623
BCS05200.1|GH47	0.0	1	1088	1	1096
BCS16758.1|GH47	0.0	1	1088	1	1096
QMW34129.1|GH47	0.0	1	1088	1	1090
QMW46185.1|GH47	0.0	1	1088	1	1090

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.04e-31	44	602	6	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.14e-31	44	602	11	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.18e-31	44	602	11	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	3.28e-31	44	602	89	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	4.79e-31	44	602	6	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.14e-119	43	606	35	481	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	1.29e-104	43	604	125	583	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	1.48e-104	43	598	130	582	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	1.75e-102	32	604	24	504	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9FG93|MNS4_ARATH	3.03e-87	31	614	28	494	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.013752	0.986216	CS pos: 34-35. Pr: 0.4869

TMHMM  Annotations     

Start	End
13	35