CAZyme Information: ATEG_01660-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01660-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1357	CH476595|CGC18	151814.94	6.5613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:1868038-1873295(-)

Full Sequence      

MDWDQDALRAQFCHALSEMYKSEVPLYGDLVDLVWKADAAAVRASQQLGGSHVIDPDEVL
PPRNRVERHGAIRLGTAHELATIRRMFAVMGMFPVGYYDLTMAGFPMHATAFRPQDRDAL
AKHPFRVFTTVLRMELLTERTRALAQKALGQRNIFTPRLMALIDRAETQGHLNPEQAQEF
IREGLETFRWHSKATVTWDEYQLLKEEHPLIADIVSFPSCHINHLTPRTIDIDLVQKMMQ
DHDMPAKERIEGPPKRVCPILLRQTSFKALEETVYFRDARGAFVKGSHTARFGEVEQRGY
ALTRAGRRLYDQILDQVNRESAEKRAHSVRYEDLLEKHFEQFPDDLAELQSRGLAFFCFR
LTPAAEKSLDAATTVDKSVGLSQLLESGILEYEPITYEDFLPLSAGGIFNSNLGNTSTSK
QLIMEADADLDGFQRMLGASVTDEFHLYEKMQSDSLERCRKQLGLDVIWSGCSDPLSCNL
LKAAPSCLPWVRTAKWQAVRMDSGQNDDQNIAYRIWVGTIVTIVPATFAVVLRFLGRHVS
RAGFWWDDYTIAIALVFNWAMAILRWVQVIYWGFGRHAAFLSEEDVRSYQKSFLGVQILY
FTNAVFTKSSLLLLYQRIFGVVSWFRWVLRFTGFLVTAYWIACSIVAIWGCSPVSYFWNM
KQPGSCINETNFFRWNGIANIILDFLVLCVPFPMLWYLKASLRQKLVLSGIFLLGGFVCV
TSIVRVIAFDLQNSVDPTYTTVDTAAWSSIEQSVGILCACLPTMRPFFRRFFQMLDGNER
LLSKGYRLTEGNPNLTVAVVEAGGFYEVDNGNLSVVPGYTTYFTGSDPNDYQPLVDWGIS
TQPQRGLADRVVHYARGKTLGGSSARNYMVYHRPTIQSMQRWADEVGDESYTFDNMLPYF
KKSVHYTPPNQTLYANTSNTQTPDAFSPDGGPLEVSFSNIVLAFGTWARKAYIALGMKQI
DGLNSGELLGSAFGTSTINPTNAHRSSSESSFLRQALNTGHGPVIYRNSHAQKILFDSDK
AATGVEVSTAGTFGTPPLSFTLNVRKEVILSAGAFQSPQLLMVSGIGSCDELRNFKIPCL
QNLPGVGKNMEDHVLFGASHRVNFPTASATANNATLAALMVEAYINNAAGSLTVFGPGYF
GWEKMPEPYRSRLSQQSIKALSSFPDDWPEIEWLTIGAFNGYGMNKQTADPRDGHNYGTI
SSALVAPLSRGSVSLAGPDMNTLPLVDPQWLVNPTDRELAIEAFKRGRQIWDKLAELGAA
DPEEYFPGPNVTTDEQIHEFIQKSMTTVYHASCTCKMGRRQDPLAVIDSSARVYGVQRLR
VVDSSSFPFLPPGHPQSVVYALAEKIADEILQGSSGL

Enzyme Prediction     

No EC number prediction in ATEG_01660-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	787	1352	5.6e-158	0.9630281690140845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
319958	VOC_YdcJ_like	0.0	6	317	1	310	uncharacterized metal-dependent enzyme similar to Shigella flexneri YdcJ. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
399801	DUF1338	1.12e-148	7	413	1	322	Domain of unknown function (DUF1338). This domain is found in a variety of bacterial and fungal hypothetical proteins of unknown function. The structure of this domain has been solved by structural genomics. The structure implies a zinc-binding function, so it is a putative metal hydrolase (information derived from TOPSAN for Structure 3iuz).
225186	BetA	2.11e-82	785	1354	23	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.45e-77	785	1351	21	532	choline dehydrogenase; Validated
227673	YdcJ	1.46e-63	6	465	8	290	Uncharacterized metalloenzyme YdcJ, glyoxalase superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW37598.1|AA3_2	4.48e-297	772	1351	47	625
QMW25513.1|AA3_2	4.48e-297	772	1351	47	625
QRD88504.1|AA3_2	4.48e-297	772	1351	47	625
UCK57946.1|AA3_2	4.48e-297	772	1351	47	625
QGA19805.1|AA3_2	2.97e-264	796	1350	78	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6W1G_A	3.43e-126	6	465	10	461	Crystal structure of the hydroxyglutarate synthase from Pseudomonas putida [Pseudomonas putida],6W1H_A Crystal structure of the hydroxyglutarate synthase in complex with 2-oxoadipate from Pseudomonas putida [Pseudomonas putida]
2RJB_A	9.60e-126	6	459	8	444	Crystal structure of uncharacterized protein YdcJ (SF1787) from Shigella flexneri which includes domain DUF1338. Northeast Structural Genomics Consortium target SfR276 [Shigella flexneri],2RJB_B Crystal structure of uncharacterized protein YdcJ (SF1787) from Shigella flexneri which includes domain DUF1338. Northeast Structural Genomics Consortium target SfR276 [Shigella flexneri],2RJB_C Crystal structure of uncharacterized protein YdcJ (SF1787) from Shigella flexneri which includes domain DUF1338. Northeast Structural Genomics Consortium target SfR276 [Shigella flexneri],2RJB_D Crystal structure of uncharacterized protein YdcJ (SF1787) from Shigella flexneri which includes domain DUF1338. Northeast Structural Genomics Consortium target SfR276 [Shigella flexneri]
5OC1_A	1.63e-50	787	1350	19	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.39e-50	787	1350	20	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.20e-48	772	1350	8	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	8.00e-179	772	1350	53	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	6.19e-173	772	1350	54	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.04e-154	786	1351	52	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.71e-142	772	1354	43	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	1.18e-139	772	1351	48	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
514	536
549	571
593	615
627	649
677	699
706	728