CAZyme Information: ATEG_01601-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01601-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	CH476595|CGC22	47632.11	5.0668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:1714950-1716248(+)

Full Sequence      

MPISKGIFLSLLSTLPLALAGHRSHRCVVPSSNGTRDDSPAIAKVFAQCATDSIIVFQEG
VDYNVFQPIKAENLSNVEIRMHGNLHLPQNISAVQEIVKAGNSYWFTLEGPRVDWTGSED
INHGWINSYGQAWWDANPPNGTGIENRPHLLSYTTSDATIKYMRSRKPIAHNCRLHGDDI
TVTHAIVDAYSTGGFPFNTDGFDVAGTNIRISDSVMYNGDDAIAVGSGSHDIVFERNTIG
YQSHGMSIGSLGKDPTDFANITNLRFEDVTVIDALYAARFKSWTGGQGLVKNVTWKNIRV
FNVTFPIFVTQSYWDQGANRGDVDESSSVMMEDFTWSDFTGSINTYQPGDGSCASDPCWY
NAGLPNLQHTEAIILECNTATSCKNFVTENIQLYPQSMDAPHLICMNATAELNPRLGFDC
RNGMYTALSERH

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	71	410	8.7e-48	0.88

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.26e-30	121	353	58	293	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	4.86e-29	33	411	57	392	polygalacturonase
178580	PLN03003	3.20e-21	33	358	34	347	Probable polygalacturonase At3g15720
177865	PLN02218	7.00e-21	33	393	78	408	polygalacturonase ADPG
215426	PLN02793	3.52e-19	124	408	151	409	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW25577.1|GH28	1.08e-254	1	427	1	436
QMW37662.1|GH28	1.08e-254	1	427	1	436
QRD88432.1|GH28	1.08e-254	1	427	1	436
BAE56325.1|GH28	1.08e-254	1	427	1	436
UCK58026.1|GH28	1.08e-254	1	427	1	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HG8_A	1.64e-17	126	354	81	322	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
4C2L_A	1.70e-17	30	366	21	364	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1K5C_A	4.40e-14	106	359	61	309	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CXI3|PGXC_ASPTN	0.0	1	432	1	432	Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxC PE=3 SV=1
sp|B8MZZ6|PGXC_ASPFN	1.92e-255	1	427	1	436	Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxC PE=3 SV=1
sp|Q2UQ40|PGXC_ASPOR	1.92e-255	1	427	1	436	Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxC PE=3 SV=1
sp|A1D7I1|PGXC_NEOFI	6.85e-245	1	425	1	437	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1
sp|A2QEW2|PGXC_ASPNC	2.28e-243	1	429	1	439	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999744	CS pos: 20-21. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in ATEG_01601-t26_1-p1.