CAZyme Information: ATEG_01560-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01560-t26_1-p1
• CAZy Family: AA8
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1276	CH476595|CGC9	141154.14	6.8383

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:1613909-1618363(+)

Full Sequence      

MPIKSVAVIGTGPSGAIAVDALVQEQAFDVIRVFERQEKAGGCWISRENETPEPLDIDRL
STRTADAPIPLPSTLPAHLPAVTQHRYADAHIYPTLHTNVDASVMEYSQEPIPAVRSDAS
IALHGPDTPFRHHTVICQYIEDLLNRNGYQDLVEYNTTVERAIKDPVSGRWVLTLRRAGA
RPGYDYWWSETVDALVVASGHFNVPYVPAIPGLKEFAQKYPGSVEHTKQYRGPEKYRGKV
HLPLPTYLLLSIDRLIADNKQKVITVGASVSAADTAVSLIGAAQDPIIAVVRGKYNVYFG
DEAFKHPQIQRRPPIARVSCEDGARTVHFEDGTSVSDVDHIIFGTGFTWTLPFLPDIPIR
NNRVPDLYLHVFYQRDPSLVFLGAVGAGLTFKLFEWQAVAAARVLAGKAQLPPLTEQQKW
EADRIAVKGDGPGFLMVNPDFEEYFEKLRALAGEPAPGAPGRRLPPFEQAWVDDFNAGHE
RRRRMWQRANREAQIRPRSAHDRGIYTAAGPREMHFTVLSWCSQMLSKHSLFFLIIPGAT
AKSLWSNTPGDYGNFITTAFPLGNGRLGEKAYAGGNPNNCRAEALPGIRDFIFQNGTGNV
SALLGEFPSYGSYQVLGNLTIDLGELENVRGYRRRLDMKSGVYTDGFAVGNALYNRTAFC
SYPDQVCVYHISSANASLPSVEIGLENQVVSPAPNVTCHANSISLYGQTFPTIGMIYNAR
ATVVVPGKSSGDFCAGTVVRVPSGQKEVYIVLAADTNYDASKGNAAAKFSFRGSDPYEKV
LQTASKAAKKSYAQLKSSHVKDFRAISDGFTLTLPDRRDSAGKPTTELIAAYTQPGDPFI
EGLLFDYGRYLFMSSSRAGSLPPNLQGLWTEQASPAWSADYHANINLQMNHWAVEQVGLG
ELTEPLWKYMADTWLPRGQETARLLYGGEGWVTHDEMNVFGHTAMKNDAQWANYPAVNAW
MSQHVWDHFDYTQDAAWYQSMGYPILKGAAQFWLSQLVQDEHFNDGTWVVNPCNSPEHGP
TTFGCTNYQQLIWELFDHVLRGWTASGDKDRLFRRAIASKFAALDNGIHIGSWGQIQEWK
LDLDTPNDTHRHLSNLHAWYPGYAMHALNNQYTNVSQAVATTLRSRGDGVADQNTGWGKM
WRSACWALLNHTETAYSMLTLAVQNNFAANGLSMYTGAPPFQIDANFGIMGAVTSLLVRD
LDRPASDQTKVQRVVLGPAIPSAWGGGSVEGLRLRGGGSVRFGWDQQGRVTWCEADLSRR
TARAPVFMVGEEIIKC

Enzyme Prediction     

EC	3.2.1.63:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	541	1255	5e-189	0.9626038781163435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405224	Glyco_hyd_65N_2	5.40e-52	544	760	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
215116	PLN02172	4.36e-32	2	412	7	355	flavin-containing monooxygenase FMO GS-OX
395602	FMO-like	1.06e-25	4	416	2	403	Flavin-binding monooxygenase-like. This family includes FMO proteins, cyclohexanone mono-oxygenase and a number of different mono-oxygenases.
224983	CzcO	1.82e-22	1	286	6	201	Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD [Inorganic ion transport and metabolism].
404603	Pyr_redox_3	8.62e-07	195	367	122	280	Pyridine nucleotide-disulphide oxidoreductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03365.1|GH95	0.0	527	1276	6	787
CAK48586.1|GH95	0.0	527	1276	6	791
BCS14993.1|GH95	0.0	565	1276	22	739
UKZ72138.1|GH95	3.61e-254	538	1250	14	765
UKZ94821.1|GH95	7.20e-254	538	1250	14	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	5.32e-87	536	1250	35	747	Chain A, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
4UFC_A	1.07e-85	531	1244	9	721	Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2RDY_A	8.87e-79	554	1244	12	732	Chain A, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	4.23e-65	550	1251	37	835	Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	2.46e-64	550	1251	37	835	Chain A, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R797|AFCA_ASPNC	0.0	527	1276	6	791	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
sp|Q5AU81|AFCA_EMENI	8.03e-240	528	1272	2	802	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
sp|Q2USL3|AFCA_ASPOR	7.07e-187	539	1250	13	700	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2
sp|Q8L7W8|FUCO2_ARATH	1.22e-83	557	1260	64	811	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
sp|Q9HFE4|FMO1_SCHPO	1.54e-37	3	457	6	411	Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fmo1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ATEG_01560-t26_1-p1.