CAZyme Information: ATEG_01500-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01500-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37901.55	6.5839

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:1439472-1440718(+)

Full Sequence      

MYGQQALLCLAGIPLIQALPPPSAGREKFDLDSTKYMLAFGDSYTYIQGTHGHQNYSFIG
DQLNFAYDAHTLLSNKIVQNQTGTAEGGPNWVEFLTGCGANEGLTSPLSCDRQLWDFVYA
GADISHTPPPQTIPSLLGHQIIQYKDYGSSHPQMHRQTRCKTLVAICIGINDINDSAKYA
VHFPTFYNDLIATLFDSVRQLHTLGYRSYLFMNLPPLDRTERNQQAAVPSPNATQIAWFN
AALQQHAHRFAQSHPRASVMVYDAHAVLADMMDHPAQYGIVNTTHFCRGYDQPDIAWNYQ
AYGCPTPVDTYFWFNSGHLTSHVHKKLAEALGETLAGWTG

Enzyme Prediction     

No EC number prediction in ATEG_01500-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	38	331	1.6e-75	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.01e-54	36	331	1	267	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	5.94e-20	120	331	85	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	5.60e-07	6	336	8	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	4.24e-04	163	329	105	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91661.1|CE0	5.36e-160	7	335	7	335
UDD64353.1|CE0	5.36e-160	7	335	7	335
QMW35262.1|CE0	6.40e-160	7	335	12	340
BCS08972.1|CE0	1.84e-149	1	337	1	338
BCR96460.1|CE0	1.84e-149	1	337	1	338

PDB Hits     

ATEG_01500-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2FKR1|AES1_THETO	1.37e-14	33	337	30	299	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|G2QJ27|AES1_MYCTT	6.31e-14	33	337	30	299	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999767	CS pos: 18-19. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in ATEG_01500-t26_1-p1.