CAZyme Information: ATEG_01419-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01419-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43761.60	6.4261

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:1201764-1202991(-)

Full Sequence      

MEGGNILFLTNSEHGQASVTLAVAHELLVRSKFAVHIASFEALAPEVSKLNKTTTSLGST
TRTAQFHGIPGRSMLECVRSRLSCSFDDLQIGFSGALNVLSLLPRMVTPWDGAEYIAIYH
GFVDIIEELRPVLVVLDPLLPHARDACRMTRQERVVLLSPNTAKDLVVQPRLENLWKYPM
ACSGYPFPLPWRLILPNAYLAFRAAWCMRSDENIREIMKCRKENGLEGEMPQFIMAQDDP
IPVLIPTTPEMDFPVSVPESFTACGPILRPWTPVADAHPELNAWLSKRPTVVVNLGSIFR
YSSALERQFAEGIRMLLDKRPDIQILWKLPRDQNMDHDGSSLDGISDAVAEGRVRIEKWF
PVEPISILLHEKVQCSVHHGGANSFYEAIR

Enzyme Prediction     

No EC number prediction in ATEG_01419-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.35e-13	5	390	2	325	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26405.1|GT1	7.50e-122	6	390	6	396
BCR88350.1|GT1	1.49e-118	6	390	4	398
QMW42118.1|GT1	6.09e-118	1	390	1	394
QMW30045.1|GT1	1.06e-117	1	390	1	394
UDD61742.1|GT1	1.06e-117	1	390	1	394

PDB Hits     

ATEG_01419-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	1.55e-80	6	389	8	386	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	7.80e-62	5	388	7	400	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ATEG_01419-t26_1-p1.