CAZyme Information: ATEG_01295-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01295-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		51757.31	4.4758

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:829827-831324(+)

Full Sequence      

MGNTTSIAAGRDCLISAVGGNAAHVAFQDQLLYQATAVDVYNLNIPVTPAAVTYPQSADE
VAAVVKCASEYDYKVQARSGGHSFGNYGLGGQNGAIVVDMKHFSQFSMDESTYTATIGPG
ITLGDLDTELYNAGHRAMAHGICPTIRTGGHLTIGGLGPTARQWGLALDHVEEVEVVLAN
SSIVRASETQNQDVLFAVKGAAASFGIVTEFKVRTEQAPGLAVQYSYTFNLGTPAEKAKL
LKDWQAFIAQEDLTWKFYSNMVIFDGQIILEGIFFGSKEEYDALDLEKRFPTSEPGTLLV
LTDWLGMVGHSLEDVILRLVGNTPTWFYAKSLGFTPRTLIPDSAIDRFFDYIHETNAGTL
AWFVTLSLEGGAINAVPEDATAYGHRDVLFWVQIFMVNPLGPISQTIYDFADGLYDVLAQ
AVPESAEHAYLGCPDPKMPDAQRAYWRGNLPRLEELKGEFDPKDTFHNPQGVSVAV

Enzyme Prediction     

No EC number prediction in ATEG_01295-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	40	257	7.9e-72	0.462882096069869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	6.06e-31	46	472	29	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	6.83e-31	49	187	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
215242	PLN02441	2.03e-14	47	219	63	242	cytokinin dehydrogenase
369658	BBE	1.78e-10	429	472	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	2.04e-09	49	223	134	312	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30198.1|AA7	2.85e-282	1	472	1	471
QRD86662.1|AA7	3.99e-282	1	472	10	480
QMW42271.1|AA7	2.34e-281	1	472	1	471
UDD61931.1|AA7	3.32e-281	1	472	1	471
CAK49173.1|AA7	2.64e-273	1	475	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZR6_A	3.53e-73	41	468	35	472	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	7.44e-72	41	468	35	472	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
3RJ8_A	2.01e-65	38	472	26	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
5K8E_A	1.91e-64	36	475	48	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	8.34e-58	41	472	53	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.99e-111	13	472	10	467	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|Q6PW77|GOOX_SARSR	1.65e-72	41	468	54	491	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	1.74e-64	38	472	48	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|G2QG48|XYLO_MYCTT	9.82e-64	36	475	48	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	4.29e-57	41	472	53	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_01295-t26_1-p1.