CAZyme Information: ATEG_01031-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_01031-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	CH476595|CGC17	71578.27	4.9506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:153087-155679(+)

Full Sequence      

MHLGGFWLAGPLLAASALAAATPDTHQNSARQTTKYAPKQPPLTTPWTDLVGTDPWPEYP
RPQLQRSKWKNLNGIWQYQDAGSLNAVQNPPFGQALANEVLVPSCLESGLSGIQGKGMYY
SWFRTNFTVPRSWTNQSVLLNFGAVDYEATVFINGKQAGFHRGGYFHFAVDAAEYVKLGA
DNELLVFVHDPTDTGDAVIPIGKQKIVPSHIFYTPCSGIWQSVWIESAPRNHIARLDLDA
NMDGEVTVHVHSSSGTSTPVEVTVFDGDDEVATHKGTSESAFRFTVPDVSLWSPDSPTLY
NVTVRMGADEIQSYTGFRTISKGEVDGVVRPLLNGEFTFMFGTLDQGYWPDGLYTAPTRE
AMVYDLKVLKGLGFNMLRKHIKVEPALFYRACDELGLLVIQDMPSLRPLESILPNAEQQK
EFQRQLELLVTQFKSFPSIITWIIYNEGWGQLIDGYPEFALTDRVKQLDPNRLVDATSGW
VDHGAGDFSDNHHYANPQCGSPFYSLSSSPFDPTRIGIQGEFGGIGHNVSIEQSSLWNDQ
TAINGINQTYEIDDTLEIWNYRSHILLSELEDQTRRFSCSGGVWTQTTDVEGEVNGLMTY
DRRVKRLLWLSGDNVPDVFEQLPGHNYKSRKPTLSLARKCE

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	63	492	4.2e-101	0.5026595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	1.81e-34	61	474	3	445	beta-D-glucuronidase; Provisional
225789	LacZ	1.82e-33	67	474	10	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	2.96e-23	67	488	39	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	4.00e-13	232	318	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397119	Glyco_hydro_2_C	7.26e-11	362	605	38	287	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58640.1|GH2	0.0	12	607	25	626
UDD59220.1|GH2	0.0	12	607	11	612
QMW41001.1|GH2	0.0	12	607	11	612
QMW28926.1|GH2	0.0	12	607	11	612
QRD85177.1|GH2	0.0	12	607	11	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.17e-113	43	607	12	570	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ECA_A	2.44e-26	122	470	95	463	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
3FN9_A	3.72e-24	106	483	52	439	Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6ED2_A	7.36e-24	122	472	94	467	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
3GM8_A	1.05e-23	121	490	68	435	Chain A, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	3.83e-27	56	472	40	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	6.33e-22	112	479	94	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P77989|BGAL_THEP3	2.75e-18	119	442	56	382	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|A1SWB8|BGAL_PSYIN	3.52e-18	72	487	51	496	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
sp|P26257|BGAL_THETU	1.07e-17	129	442	64	383	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.052164	0.947822	CS pos: 19-20. Pr: 0.8239

TMHMM  Annotations     

There is no transmembrane helices in ATEG_01031-t26_1-p1.