CAZyme Information: ATEG_00990-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00990-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	CH476595|CGC19	44987.15	6.1505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476595:29503-30690(+)

Full Sequence      

MVEKKFVPISLFPKRARRFTHGGLVALFLFIYFCVTRTSHNFSETQLYSTKVRGNVGETF
PRKIWQIWKVNPLEFDGRDIEVARSWTAKNPGYRYEVLTDQNDLEYVETNFGPLGENRPD
IVETYRSLTAPIIKADLLRYLVMYIEGGVYADIDVEALRPVERFIPSTHDERDIGMVIGV
EIDEPQFSDHPILGPKSQSFCQWTFMCKPRQPVMMRLVENILHWLNELSIKQGKPISELQ
LDFDDVITGTGPSAFTGAILSEMSRATGKTVTWNTFHDIPESKVVGGFLVLTVEAFAAGQ
GHSDSGTHNSRNALVKHHYHASEWPKRHPRFHHPIFGEVERCNWNVDCVKKWDEGTAAFA
ALPQEEQERQIATFQAIGEALKDMDPPLEPAFGGF

Enzyme Prediction     

No EC number prediction in ATEG_00990-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	83	166	2.3e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.07e-24	58	221	80	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.68e-15	78	168	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP95522.1|GT32	3.81e-251	1	387	1	385
QMW40889.1|GT32	6.25e-191	13	377	7	368
BAE58544.1|GT32	6.25e-191	13	377	7	368
UDD56882.1|GT32	6.25e-191	13	377	7	368
QMW28814.1|GT32	1.26e-190	13	377	7	368

PDB Hits     

ATEG_00990-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.52e-33	67	324	146	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.08e-28	60	317	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.45e-27	60	296	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.80e-21	61	239	97	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.02e-08	47	165	44	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000010	0.000002

TMHMM  Annotations     

Start	End
21	40