CAZyme Information: ATEG_00914-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00914-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	CH476594|CGC13	87871.68	5.6265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:2574787-2577616(-)

Full Sequence      

MRFLGIAAVATFSTVVSAYPKSTALYNCVSSVFGPSAPQRIVTPNDTTYLDSRLGETIQF
DELPVLLAYAQESKEIAPLIRCAKTAGIKAVPRAGGHSFEAYSALNGTLIIDIAHLNYVN
VSDDRQTAVVGAGIRLGALYTALSEHGTSFIGGICPTVGLAGFLGSGGFNMQQRSQGLAV
EHVLAAKVVLADGRTVVASPDTNPDLFFAIRGGGGGTYGIVVEFTLSLTSIPRSAMLMLS
WNDTASRFPAAKQYLDWAPKQIPEFMSQINVYRDKVQVLGWYYGGTEDELRSLVNASGLL
DIGKPAVVIAGGCNTDNARAFGYTTMECLPDGKVDVSILNVVPDPFSKVGNSTQFKWNEV
PKSTSMPVADPWQRFHRMSKSFFVLKDNPLTDQTLQSLLDRIASLDAKSQVWGEWHAWNI
STPSKGSGNAFAWREKAYAHLEFQIHGAPDDKERQSTYENWLEDLESYLRPTVGGASYSG
YLDADISTDPLTSYYGGNVCKLVSVKRKTENDYSSSTVEQLFIDSDVNARKITSRYPIPP
PDKSIKTEDITLQDCWVRIYTPPSATSSGSVAVFIHGGGWIMGSPDIEDATCRRICRCSG
MTVVSVGYRLAPKFQFPTGLNDCVRATLWTLGHFPVSALVIMGGSAGANLAFGVALKLVD
AGLGEKVKGVLALVPATVHPDAVPADKRDQYTAMHENANNTVNTLAAMDCFLDAYAAPPH
DKYFSVLLHPRLKDLKKVYLVECGTDTLRDDARLMRDALEEAGVPLMYDAYPGYPHYFWS
YPSPVLAEASESFHENMLQALAWLDQE

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	59	271	1.9e-63	0.462882096069869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400284	Abhydrolase_3	6.81e-52	573	779	2	208	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
223730	Aes	1.04e-43	514	789	23	299	Acetyl esterase/lipase [Lipid transport and metabolism].
396238	FAD_binding_4	7.21e-25	64	199	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
236660	PRK10162	2.02e-24	557	781	71	294	acetyl esterase.
223354	GlcD	4.65e-23	59	303	27	282	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16207.1|AA7	1.66e-29	23	512	75	542
UJO18775.1|AA7	9.04e-29	20	291	29	304
AHG26149.1|AA7	1.08e-28	64	506	42	452
QRW06655.1|AA7	1.09e-28	11	506	22	480
QRV77710.1|AA7	1.09e-28	11	506	22	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	5.54e-38	40	508	24	455	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	5.54e-38	40	508	24	455	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6KD0_A	8.12e-29	557	804	80	337	Crystal Structure of Vibralactone Cyclase [Boreostereum vibrans]
4YPV_A	2.98e-28	546	780	87	324	High-resolution structure of a metagenome-derived esterase Est8 [Parvibaculum]
5K8E_A	5.61e-28	4	307	6	311	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZH0|PYTB_ASPTN	0.0	1	807	1	807	FAD-linked oxidoreductase pytB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pytB PE=2 SV=1
sp|A5ABH0|PYNB_ASPNC	4.74e-201	21	512	31	522	FAD-linked oxidoreductase pynB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pynB PE=1 SV=1
sp|Q6UEG5|AFLJ_ASPPU	1.08e-90	529	804	38	313	Versiconal hemiacetal acetate esterase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflJ PE=1 SV=1
sp|Q00675|STCI_EMENI	6.69e-83	531	804	10	284	Versiconal hemiacetal acetate esterase stcI OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcI PE=2 SV=1
sp|M2YJ38|EST1_DOTSN	3.04e-39	539	804	45	315	Versiconal hemiacetal acetate esterase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=Est1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999719	CS pos: 18-19. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in ATEG_00914-t26_1-p1.