CAZyme Information: ATEG_00734-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00734-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		68178.70	5.1756

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:2071457-2073346(-)

Full Sequence      

MLCVRKSYAIPTVILICLTYFLFASLPPGAGQTSLEDVADLTEFYNTKDQAGDGRLHFIK
HSEKHPVSKYIPLPSGSPSPIPRIQSEFPAESWWTRRTRVKRQEAVKAAFKHAWQGYRNH
AWMHDELSPLSGGTRESFAGWAATLVDSLDSLVIMGLMDEFEEALEAIEHIDFSTTHATQ
INIFETTIRYLGGFLGAYDLTNGTYPILLKKATEIADMIYASFDTDNRMPQSRWDWTRSA
EGLNIHPSKNTILAELGSLNLEFTRMTQLTGDPKYFDAVQRITDLLEESQKKTRMPGLWP
LMVNAEDMTFPDPRFSVGGMADSTYEYLPKEHMLLGAQTKQYRKMYDAAMDPIKKRLLFR
AMTKDKKDVYFAGNMRAQFTYSRETLEPQVEHLKCFLGGTVGIGAKVFDRPDELSIARKL
TDGCIWAYDIMPTGIMPEIMYVSPCKDLDNCEWDEEQWYKDILKRSAKAAQEEDPYSEAK
EFIKRRGLPPGVTQITDAQYKLRPEAIESVFIMYRITGDKELQDAAWRMFSNIEKITRSE
YGHAAIDDVRNPKSPQLDYMESFWLAETLKYFYLTFSEPDLVSLDEYVLYVDRV

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	109	589	1.6e-164	0.9775784753363229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	109	589	1	444	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.81e-128	61	589	26	509	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83088.1|GH47	3.36e-315	1	594	1	588
QMW28572.1|GH47	4.43e-314	1	589	1	583
QMW40643.1|GH47	1.27e-313	1	589	1	583
BAE58298.1|GH47	1.27e-313	1	589	1	583
UDD56616.1|GH47	1.27e-313	1	589	1	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	6.10e-67	104	578	7	448	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.44e-66	104	578	42	483	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	1.41e-64	102	588	5	441	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	1.51e-64	102	588	5	441	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	1.63e-64	102	588	10	446	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9CXX8|MNS1B_COCPS	2.30e-67	81	577	23	487	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|P31723|MAN12_PENCI	7.43e-66	104	578	42	483	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q12563|MNS1B_ASPPH	1.14e-63	98	578	38	485	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A1D1W1|MNS1B_NEOFI	5.27e-63	105	575	35	472	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.16e-62	98	578	38	485	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004230	0.995724	CS pos: 31-32. Pr: 0.9425

TMHMM  Annotations     

Start	End
7	26