CAZyme Information: ATEG_00720-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00720-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		59783.53	6.7260

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:2022560-2024261(-)

Full Sequence      

MRTYLTSSLLAASWAFNALAHTEPGHHRPQEYDYIVVGGGPSGIITAERLAEANKSVILL
ERGYGPTVATGSNHTLPWNNTLTPIVVPGLSFDIGNMDLWNDYICSDTGGTAACVLGGGV
TVNYMVFVHPPARDFDDKWPQGWKWRDVQPAAERLYARNPGSLLPSADGKYYDQGLYNTL
SRFFSRLGWKSVDMIAQPDEKHDVYSYPAWNIKDQRRAGPVRTYLPLAQQRKNFVLRTGT
KATRLIRAGSTVRGVEVETDRAGREVIPLAPRGRVVLAAGALSTPRILFNSGIGPSAQIE
TARRSGVVLPPRREWIDLPVGVGLKDHPIFSIEVKTNGTFAPLDAQAILNGSAVRDIQLY
EDAGSGVLTEGKHRMIFFTSRMASDNQTRYYQGSCAPTGEGVFTITAYMTHGITSSGVLG
LDAKQNTVIEKSPYLQTPADREAARDFIEQMVGDITAPGTGFELQTYTNTSAILDSLTSG
IHWTSTTKMGSDDGRLNGTSVVDTNTKVYGMDNLYIVDGGIHPDLPTGNIQAAIMIVAEA
AVKKILEQE

Enzyme Prediction     

No EC number prediction in ATEG_00720-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	27	548	4.7e-190	0.9762773722627737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.63e-57	31	547	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	8.32e-36	33	541	2	482	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	5.79e-33	30	546	4	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	4.16e-23	109	329	8	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.51e-20	434	541	24	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44335.1|AA3_1	1.49e-275	1	546	1	547
GAA84602.1|AA3_1	4.03e-273	1	546	1	547
BCR93747.1|AA3_1	4.03e-273	1	546	1	547
BCS06374.1|AA3_1	4.03e-273	1	546	1	547
CAP85828.1|AA3_1	4.12e-269	1	546	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NAA_A	1.22e-95	32	546	3	535	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	1.40e-95	32	546	8	540	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI7_A	6.04e-95	32	548	230	766	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	1.39e-91	32	546	8	543	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	2.06e-89	32	546	230	765	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.72e-92	32	546	235	767	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q985M5|BETA_RHILO	2.94e-23	31	546	3	527	Oxygen-dependent choline dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=betA PE=3 SV=1
sp|A8JHB7|FAP_CHLRE	3.73e-23	30	541	44	592	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.66e-22	31	546	2	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	4.15e-22	30	549	3	534	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000656	0.999303	CS pos: 20-21. Pr: 0.9714

TMHMM  Annotations     

There is no transmembrane helices in ATEG_00720-t26_1-p1.