CAZyme Information: ATEG_00646-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00646-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
922		98853.42	4.7988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:1812140-1814961(-)

Full Sequence      

MASFRSLLTLLLAHLSLLTFVHAVPTPQGLDLAAHVAVASSDYWVANIKRQGTVAFGNNT
DYKVYRNVKDYGATGDGSTDDTAAINKAIADGNRCGQGCDSSTVTPALVYFPAGTYVVSK
PIIQYYYTQMVGDALDLPVIKAAAGFTGMAVIDADPYTDDGSNWYTNQNNFFRAIRNFVI
DLTAMPQGSGAGIHWQVGQATSLQNIRFEMIKGGGDANKQQGIFMDNGSGGFMSDLTFNG
GNYGMFLGNQQFTTRNLTFNDCNTAIFMNWNWAWTFKSLNINNCNVGLNMSNSPQNQTVG
SVLILDSQLTNTPTGVVTAFTQNSIPTGGGALILDNVDFSGSKAAVAGIDGNTILAGGSV
VKNWVQGNTYRPGNSVQKRAMRPSVEVVTETVVETVSVCPAGQTEPASTVVPTSTAESTQ
QTDRIVFPTPAGSLSQPGFDFPGTQSNEPSKPTAAVPTTSAPEVVTKPSTTIKPTSTAET
KGPAETTVPAHPSHTKPTSTATAVHGSGQCASKTVTKTRLQTVVPGGDKPKALLTGGDKI
FERSKPLYEQYAASAFVSVKSAGAKGDGVTDDTAVIQKVLNSAKDGQIVYFDHGAYIITD
TVKVPKNIKITGEIWPLLMAYGKKFADEQNPIPMLQVGEPGDQGSVEISDLVIETKGPAP
GAILMEWNVAGAEQGSVAMWDTHFRIGGSAGTELQSDKCSKTPKQTTTPNSECIAAFMLL
HVTEKSDAYIENAWFWTADHDLDLPDHNQINVYNGRGVYIESQGPVWLYGTASEHNQLYN
YQVSNARNVFMGLIQSETPYYQANPNALVPFTPQTKWNDPDFASCTTDACRKGWALRVMN
TTDLWVYGAGLYSFFENYGQTCLNSESCQENIVEVDCSDVHIYGLSTKASVNMVTSSNGQ
GLVPEDENTSNFCSTIALFEQS

Enzyme Prediction     

EC	3.2.1.58:16	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	495	919	1.3e-179	0.5635135135135135
GH55	36	411	5.1e-145	0.5067567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.34e-100	65	289	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	5.28e-10	556	613	1	61	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
411345	gliding_GltJ	1.53e-06	340	559	366	565	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
223021	PHA03247	6.92e-06	364	503	2715	2872	large tegument protein UL36; Provisional
282904	Herpes_BLLF1	3.82e-05	400	530	455	593	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW47168.1|GH55	0.0	1	922	1	950
QRD91479.1|GH55	0.0	1	922	1	950
QMW35104.1|GH55	0.0	1	922	1	950
BAE64877.1|GH55	0.0	1	922	1	950
UDD64170.1|GH55	0.0	1	922	1	950

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	5.30e-290	39	922	2	756	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.59e-201	35	922	17	758	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	3.92e-06	557	612	75	139	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]
3GQ7_A	9.75e-06	557	612	23	75	Chain A, Preneck appendage protein [Salasvirus phi29],3GQ8_A Chain A, Preneck appendage protein [Salasvirus phi29],3GQ9_A Chain A, Preneck appendage protein [Salasvirus phi29],3GQA_A Chain A, Preneck appendage protein [Salasvirus phi29]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	0.0	10	921	14	875	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.13e-177	29	916	34	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.34e-50	62	899	61	737	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000181	0.999822	CS pos: 23-24. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in ATEG_00646-t26_1-p1.