CAZyme Information: ATEG_00487-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00487-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	CH476594|CGC9	74030.25	4.8243

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:1383476-1385622(+)

Full Sequence      

MLGLRSLGLFALLASVIASGHDYGHQRLHARYVTNTTTEYDYVVVGSGPGGGPLAARLAI
AGYKVLLLEAGDDQGNATKFQVPALQLQSTEYEPMRWDYFVHHYQDLERQEQDSKMTYRT
PSGDLHVGPNPPANSEPLGILYPRAGTLGGCSAHNAMITIYPYEKDWEDLATLTGNDSWA
PDEMRKYFEKLERNRYLPSSLAGHGFDGWLTTSLTRLELVVEDQKLLSLILGAATAAGKS
LLGKVINTVTGLADVLLRDLNSNLPFRDQWGGLYQVPLAVDVPDYRRTGPRDFLMDTINA
VNDDGSRKYHLDIQLETLVTNVRFDNTTAAAGGKPRAIGVDYLRGKSLYRADPRAAPTGT
PGTRGSVNAAREVILAAGAFNTPQLLKLSGIGPRAELEKWGIETVVDLPGVGKNLQDRYE
TTVVGEAKTDFVLTSRCTFMYEMPDPCLEQWENNVLDKGTYTTNGIAIAIIRKSSTTDGD
PDLLISGAPANFRGYFPNYSYEGLKDARHWAWITLKARAGNTAGTVELRSADPRDMPVIN
FNSFDTGTTADGADEKDLQAVYEGMQFSRTVFDDMIPLDGSFEEVWPGRNVSSEQDMKDF
IKREAWGHHACCTNPIGTDDDPNAVLDGDFRVRGVDGLRVVDASVFPKIPGYYIALPIYM
ISEKAADVIIGDAR

Enzyme Prediction     

No EC number prediction in ATEG_00487-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	39	670	1.4e-95	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.81e-64	54	674	22	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.23e-59	36	673	2	535	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.84e-32	524	665	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.41e-16	140	420	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.57e-14	311	651	235	558	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39616.1|AA3	0.0	1	673	1	677
QMW27545.1|AA3	0.0	1	673	1	677
UDD55433.1|AA3	0.0	1	673	1	677
QRD81945.1|AA3	0.0	1	673	1	658
BCS05589.1|AA3	0.0	51	673	49	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.03e-39	39	673	7	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	1.40e-39	39	673	7	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.89e-39	39	673	7	564	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.89e-39	39	673	7	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.27e-39	39	673	23	580	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1U8QYA8|CICC_EMENI	3.29e-48	2	673	1	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.14e-44	39	671	2	527	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	3.86e-44	38	672	3	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	4.57e-43	39	671	4	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	5.01e-43	40	670	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000780	0.999206	CS pos: 20-21. Pr: 0.8842

TMHMM  Annotations     

There is no transmembrane helices in ATEG_00487-t26_1-p1.