CAZyme Information: ATEG_00157-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00157-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	CH476594|CGC4	94934.34	4.9112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:462697-465506(-)

Full Sequence      

MGSMRSNVDIDSLLSQLTREEKVSLLSATDWWRTPVIQRDGFTIPHIKTTDGPNGARGES
YVSGIKAACFPCGTSLGASFDRDLLFRTGQEIAREAKTKSANVLLAPTLNVIRSPRGACP
LIDRYGGRNYETYSEDPFALGVLAAAFVNGCQSEGIAATPKHFVANETENNRTILTVDVD
SQTLREIYLLPFQLVMKHSSPLCLMTSYNRVNGTYVADSEQLVNGILRGEWGFQNLVVSD
WMGVYSTAQCLNAGVDLEMPGPTKLRGEKLLQAIEQGEVSDATINASARRVLELARVLGR
FENPEEPPEQSVSNTGRDLFIRDASAAGMVLLKNDGDILPLPKASTVTVVGYHALHVALG
GGGSARVDAIHAVSPVEGLRAAGYEVDACPGVPVYGALPHPDAALMYDSVSKTKMPEPVR
VEWFNGCTIGEKLALEETKALPEYMIKEKWPSYLEQIYCTRMTYDVCPSSSGEHLLSVIS
TGPAICYINGERVFERPQETDLRPESFYFFKSQLERRFTYPMEAGKFYTLVLESWNTDQE
ILHGKPLYGRMFQGSSLRFQEFVDENQRIREACESAQRSDYAVVCVGTTSEIESEGFDRS
SMDLSSSQYEQIQAVAAANSRTIVVNFSGSPVTMTAVVDQVPALIQAWFPGQECGHSLAR
LLSGDVCPSGRLPFSWPRQDEDNPTFHNFPCDEDNVVRYEEKLDVGYRFYDRPESPMPLF
PFGFGLSYTQFHVTGLRVKRTVFSGLDVSVELICDAKNVGARDGAAVLQYYVQPPLGAGT
GGCKRPIKELKEFQKVYLVAGESREVQITLDKYSISYFNAERDSWVADPGVYKVHLGTSS
QDVVGTVSFVVREPLAWKGL

Enzyme Prediction     

No EC number prediction in ATEG_00157-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	42	260	5.8e-59	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.21e-78	70	843	120	757	beta-glucosidase BglX.
224389	BglX	1.28e-69	36	388	52	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.48e-47	329	728	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.78e-42	12	811	55	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	9.31e-41	70	294	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95967.1|GH3	0.0	10	860	6	851
QKD60297.1|GH3	0.0	13	860	10	834
QGI87776.1|GH3	0.0	11	860	5	831
CCT75026.1|GH3	0.0	11	860	5	831
QGJ01306.1|GH3	0.0	11	860	5	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.87e-167	6	860	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.14e-162	6	860	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.29e-114	8	844	3	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.88e-92	14	843	9	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.04e-88	13	848	57	825	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	1.16e-174	10	860	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	2.05e-173	10	847	11	834	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|B0Y8M8|BGLJ_ASPFC	1.03e-172	10	860	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	2.04e-172	10	860	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	6.28e-170	9	860	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000017

TMHMM  Annotations     

There is no transmembrane helices in ATEG_00157-t26_1-p1.