CAZyme Information: ATEG_00018-t26_1-p1

Basic Information

• Species: Aspergillus terreus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus terreus
• CAZyme ID: ATEG_00018-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907		98308.27	6.8950

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AterreusNIH2624	10551	341663	150	10401

• Gene Location: location=CH476594:59254-62117(-)

Full Sequence      

MGFDGTTVSPQIRSLIEKYHLGSVLLTAKNLKSAEDATRLVLELQTIARDAGHPVPLLIA
LDQENGGVNSLYDEIYIRQFPSAMGIAATGSKSLAHDVALATAQELKAVGVNWILGPVLD
VLTNVRSQPLGVRTTGDDPQEVSQYGVEFMKGYREAGLVTCGKHFPSYGNLEFLGSHTDV
PIITESLEQLSLTALVPFRNAIIHGLDSMMVGGVSMSSAGVNVMHACLSEQVVDDLLRKD
LKFNGVVVSECLEMEALTHNIGVGGGTVMAKNAGCDIVLLCRSFPVQQEAINGLKLGVEN
GIIGRARIEQSLRRVLNLKAKCTSWEQALNPPGVPSLTQMQPSHTSLSTRAYNSSISVVR
DKKNLLPLSNILEPNEELLLLTPLVKPLPASAVSRTVAEHLNSTIDLTALDRTASVLSGE
SVFKELGRSLSRQRNGRVLHTSYTANGVRPIHESLIDRASAVIVVTADANRNLYQHGFTK
HVSMICRSQFTPTGEHREKPMIVVAASSPYDFATDLSIGTYICTYDFTETALEALVKVLY
GELTPMGTLPGSISRSQKLHQARQHWLVENWNEERDSHALDTLLESVRGDCTQGELSELL
GVTSSSFLLRREDIDESHFVVRNSSTQALYGFCSTYYFKSTGTGVIGSLIVDPARRKLGI
GSSLHHRAIRTLLQRTGVKRFQLGSRLPGIYLGIPSANPVERKRLRQWFANLGWNTSLSR
PVCSVILRNLANWVPPDGLIQGLQNADVAYDLVHGYDYADSILDHVKTNSRQGVIDIYKV
ALGGAPNCGIIRATRPADGAVLGTVVVYNTRSTLAEHMPALKATHVPAGGISSPVISPSV
GEYATIMQGLVLLGIKQIRKQGAEAVVMDCVDGDSNFDCVSNIGFSTLHSFEEVNCDAGT
WTIMTAS

Enzyme Prediction     

No EC number prediction in ATEG_00018-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	54	279	1.2e-52	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.80e-69	1	369	10	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.26e-62	2	318	13	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.86e-35	5	314	10	308	beta-hexosaminidase; Provisional
185053	PRK15098	2.71e-08	79	319	119	353	beta-glucosidase BglX.
178629	PLN03080	3.40e-08	80	550	114	585	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15461.1|GH3	0.0	1	907	25	931
BCS03847.1|GH3	0.0	1	907	7	913
BAE65506.1|GH3	0.0	1	907	54	961
QRD92904.1|GH3	0.0	1	907	7	914
QMW48185.1|GH3	0.0	1	907	25	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	7.35e-85	2	714	20	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	7.04e-60	2	554	24	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.63e-43	6	553	71	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.11e-43	6	553	45	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.93e-43	6	553	75	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.38e-42	6	553	71	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.12e-34	6	554	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	1.08e-33	20	369	56	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	4.05e-27	5	308	12	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	1.10e-26	1	282	8	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATEG_00018-t26_1-p1.