CAZyme Information: ATCC64974_97830-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_97830-t41_1-p1
• CAZy Family: GT47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	OGUI01000017.1|CGC20	39185.74	5.3690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:626462-627669(-)

Full Sequence      

MKRLMYLLVVLLLSYVVCALPYDDHGKKRDLGPLSDLPGGDVIVWVDQAGNALANNVVGG
GNSDPTATADNSPTTLPPILSTLDGDLDLSPAVPLPASTNLPKTGNYRRFGISYSPYNND
GSCKSQDQVDEDLDKLAQYGFVRIYGVDCDQTNKVTKAARQRNLKVFAGVFDLQNFPSSL
DYITGAANGDWSVFHTINIGNELVNDGKNSAADVVNAVNTARSKLRAAGYQGPVVTVDAF
SVMIQHPELCQASDYCAANCHAFFDNNNTPDKAGQYVKDQANKVSKAARGKKTLISESGW
PHNGQPNGKAVPSSLNQQKAIASLQQTFTGEDELVLFTAFDDLWKQDSSGTFGAEKFWGI
QKH

Enzyme Prediction     

No EC number prediction in ATCC64974_97830-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	111	361	2.5e-23	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.51e-69	75	360	18	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47997.1|GH17	5.82e-271	1	363	1	363
BCS13276.1|GH17	9.59e-245	1	362	1	362
BCS01560.1|GH17	9.59e-245	1	362	1	362
ACQ00076.1|GH17	6.54e-133	38	361	19	362
QMW24913.1|GH17	7.10e-128	1	362	1	325

PDB Hits     

ATCC64974_97830-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	3.27e-68	111	360	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	1.37e-66	111	360	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	6.58e-63	111	360	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	6.69e-44	91	359	284	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	8.08e-43	99	359	336	596	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999764	CS pos: 19-20. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_97830-t41_1-p1.