CAZyme Information: ATCC64974_96340-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_96340-t41_1-p1
• CAZy Family: GT35
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	OGUI01000017.1|CGC35	93629.11	5.3075

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:172990-175587(-)

Full Sequence      

MPHEKRVSSQVRQLLQSLTLEEKVALLAGKNMWETVNIDRLHIPSLKMTDGPAGARGSKW
TYGSLTTWIPCGISLAATFDPAMVEEVGRVLGQEARRKGCQVLLAPTMNLSRSPLGGRNF
ESYGEDPYLVGVIATAMIRGIQAHGVGACMKHFILNDTETRRFNVDQTIDERTLREVYMK
PFTMVLNDPASTPWTAMVSYPKINGLHADISPHILPRLLRQELQFDRLVMSDWGGLNSTA
DSLRATTDLEMPGPAVRRGERLLAAIRAGEVEVAAHVDPSVRRFLQLLERTGLLGNATES
AEHSEAATDDPIFHRIARDAAQSGLVLLKNDKGILPLKPTTLQRVAIIGPNACQPTAGGA
GSAAVNPFYVSTPEACLRDALHAANSELQVSYELGISSSLRPPLLGKLLTVPDGSRKGWQ
VSFFEGHALEGPVVASSMWDDSLVYLFSDGDVPAVLDDRPYSYRATGVVTPQESGRYTWS
LANTGKAKLFVNDELLIDNTEWTGLTGGFLGCSSADKTASVYLEAGRAYQLRVDNVVTLP
VVEAFDNTLFPRISGLRVGLALEQDELEMLARAVAAARQADVAVVVVGHNKDSEGEGGDR
ATIQLPGRTDELVAAVCAANPNTIVVVQSASAVAMPWVDAASGLVMAWYQGQENGHALAA
ALLGDCDFSGRLPITFPRRLEDHGSNAWFPGEAAQDRNTFGEGVRVGYRHFDAQGIPALW
PFGFGLSYTRFQLTDIRVCGRVEGRSPESQPVLIQARVCNVGGRDGQEVVQVYVAPSAGI
REAGEMSFPKTLAGFCKISVPAGDSREVSIPIRGSELSWYDARVAQWRLDAGKYACWVGR
SSSHIDAELEIEVAEGEGTRQGTLE

Enzyme Prediction     

No EC number prediction in ATCC64974_96340-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	252	1e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.83e-70	30	352	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.18e-52	40	842	101	754	beta-glucosidase BglX.
395747	Glyco_hydro_3	5.70e-40	40	287	63	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.50e-36	588	728	99	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.15e-29	7	812	49	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48047.1|GH3	0.0	1	865	1	865
BCS13433.1|GH3	0.0	1	862	1	862
BCS01725.1|GH3	0.0	1	862	37	898
QMW31943.1|GH3	0.0	3	853	4	851
QRD91011.1|GH3	0.0	3	853	6	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.85e-145	11	853	6	836	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.12e-140	11	853	6	836	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.72e-106	11	853	5	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	3.23e-100	8	853	51	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	6.11e-87	15	858	9	667	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	2.88e-170	11	853	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	9.32e-166	1	851	1	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	9.87e-152	11	852	6	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.75e-151	7	852	2	830	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.86e-151	11	852	6	831	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_96340-t41_1-p1.