CAZyme Information: ATCC64974_96100-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_96100-t41_1-p1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		51848.53	5.7573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:80617-81981(-)

Full Sequence      

MPIGSDLLASMAKRKLARSARVASWDQKGLNEDAFVVLPGESIVLADLEGPGAITHLWFV
QTCRKILGPGLIPYSKSGVAMMEIHNALGLNYEVSDPDYYRKVLIKMYWDDSTTPNVIAP
IGDFFCLGHSMAANFQSLPFTVSVKPSEEKKFGGAAAFNCYLTMPFNKRARIEIENENDE
AYFQYFYIDYELYAEPLPADTLYFHAHWRRMNPTNGWAPSRIQTNSLETQIPNLDGKDNY
VILETEGAGQYIGCNHSVAHFQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFTQGWGMQ
KNAYPFCGSIIHEEDVPNYQVSYRWHLTDPVRFNKKIKVTLESGHANHLRDDWSTTAYWY
QTLPGPKLEILPVEKRIPRKPQFPPSDDVPEPHVNSMSAQQQAMVKQRDERMAAFVKDRN
EWLQRRAGDSQERARNNVIICEDIRRRFLQGLGV

Enzyme Prediction     

No EC number prediction in ATCC64974_96100-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	100	361	3.2e-80	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	5.24e-114	101	361	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39208.1|GH172	0.0	1	454	1	454
CAP93243.1|GH172	0.0	1	453	1	453
QKX59927.1|GH172	6.12e-297	3	452	5	455
UPK94269.1|GH172	2.01e-291	3	452	7	456
QKD59092.1|GH172	2.39e-286	2	452	4	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	4.85e-163	5	384	5	386	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	3.37e-50	18	361	20	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

ATCC64974_96100-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_96100-t41_1-p1.