CAZyme Information: ATCC64974_96050-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_96050-t41_1-p1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		31211.19	4.7200

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000017.1:53992-54952(+)

Full Sequence      

MVAAAIANASFVVVDRPNPITGLNAFGPVLNESYASYVGRRPIAQAHGMTTGELASMFVG
ENWIQEAANGSDLNLEVILMKGWKRSMTWKDTNLPWVMPSPNMPTPETALIYPGARMFEG
TSISEGRGTTRPFELLGGSFTNDSWTDEMRALNIPHTNFRSACFSPTTSKFQSQTVCGLQ
SYVFLDSIGDYEEFDPVFLGVSLLWSAKHLYTVGGNDTGFGNTTQSFHWLFGSKTGLYDV
DVLTGGSLVREGIEAGLPPDEIRSQWEADLQAFKKKRETYLLY

Enzyme Prediction     

No EC number prediction in ATCC64974_96050-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	1	283	1.3e-80	0.7070422535211267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399810	DUF1343	3.96e-118	1	283	103	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
226393	YbbC	7.24e-75	1	283	149	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39216.1|GH171	7.54e-205	1	283	145	431
QGA18334.1|GH171	7.49e-185	1	283	145	425
UNI16955.1|GH171	4.76e-128	1	283	149	434
QYJ16828.1|GH171	3.91e-81	1	283	168	434
QEU75291.1|GH171	1.79e-79	1	283	166	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	2.40e-26	3	283	138	398	Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	8.20e-25	13	283	139	368	Crystal structure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

ATCC64974_96050-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000007

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_96050-t41_1-p1.