CAZyme Information: ATCC64974_91980-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_91980-t41_1-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		42912.65	4.0474

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000016.1:1619620-1621495(-)

Full Sequence      

MLVTPLIALLPAIAAAQVSGTVGPRTSASAKAAEKVCNVLDYGASANSTNDIGPPLKEAF
QDCQTGGLVEHTNDIEIFSNNSAGAIQGYGYLFHEQDEYGPRILRLNNVTDFSVHDLILV
DSPAYFLNLVESYNGEVYNMVIRGASMGGLDGIDISGANYWIHDVEVTNGDECVTVKSPS
ANVRVENVFCNHSGGCAMGSLGTDTNISNIEYENIYTYNSTQMYMIKSNGGNGTVTNCSF
KNFIGYSNAYMLDLDTYWGDQSDGDGIKYENIGFENWKGTSSNGIQRSPIRILCPDENPC
TNITLTAVELWTDTGDYVKQECSSAYGEGECLRQQNGTLASYSFTTTITSVPVTAYSPTT
TMPGLISTSMDTTTSIPIPTIPTSFFPGASAYSTLMANM

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	50	323	1.2e-50	0.8092307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215426	PLN02793	2.32e-22	84	327	151	411	Probable polygalacturonase
215540	PLN03010	1.75e-13	83	328	146	392	polygalacturonase
395231	Glyco_hydro_28	8.78e-13	101	310	85	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
178580	PLN03003	1.84e-12	74	363	111	420	Probable polygalacturonase At3g15720
177865	PLN02218	2.14e-11	101	310	192	408	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96934.1|GH28	5.59e-266	1	399	1	443
ABD61570.1|GH28	5.59e-266	1	399	1	443
BAE66335.1|GH28	1.81e-144	6	398	11	448
UDD65679.1|GH28	1.81e-144	6	398	11	448
QRD92579.1|GH28	2.57e-144	6	398	11	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	7.17e-139	17	395	1	420	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	1.23e-13	38	315	60	365	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QWT2|RHGD_ASPNC	9.93e-267	1	399	1	443	Putative rhamnogalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgD PE=3 SV=1
sp|B0Y0Q3|RHGB_ASPFC	8.62e-148	6	398	11	446	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rhgB PE=3 SV=1
sp|Q4WV23|RHGB_ASPFU	8.62e-148	6	398	11	446	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rhgB PE=3 SV=1
sp|A1DED1|RHGB_NEOFI	1.19e-146	6	398	11	446	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1
sp|Q2TWN8|RHGB_ASPOR	3.22e-145	6	398	11	448	Probable rhamnogalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999709	CS pos: 16-17. Pr: 0.8533

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_91980-t41_1-p1.