CAZyme Information: ATCC64974_91660-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_91660-t41_1-p1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		37944.17	3.7436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000016.1:1528681-1530241(-)

Full Sequence      

MVSSLFLTLATFASAYALAVNKRFDNGDFPTGDTDPNVTSASSSTSTVSTVSSSLLSTTT
AAPAPGTTTGAGSPSPTQGGLSSSCDAFYYVEAGDSCWAIVNSYGNFTLNQFYSWNPAVK
SDCSGLQPDYYVCIGVAGDTTVASQTTLPATTTASAATSTGSYLPEQTGIASNCDKYYYV
QHGDTCSDIATNHDISLNDFYSWNPAVGTTCSDLEADYWVCVGVSGGATATTTTSTSTST
STVSSTTPTSNAPSPTQSGLVGDCSTYYEAKSGDSCWFIVNDKYTYLTTSLFEEWNPAVG
SDCSNLQPGYYYCVATQKQAPMPDTIDTCKKWHLVADGDNCWSIEQDAGVTASQFNMWNP
S

Enzyme Prediction     

No EC number prediction in ATCC64974_91660-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	1.04e-11	66	359	310	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	1.31e-09	176	211	1	36	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	6.32e-07	88	132	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	5.78e-06	267	314	1	44	Lysin motif.
197609	LysM	1.05e-05	177	222	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40753.1|CBM50	1.16e-201	1	360	1	364
BCS04737.1|CBM50	6.38e-179	1	360	1	418
BCS16307.1|CBM50	1.55e-100	1	226	1	284
QKX62165.1|CBM50	9.12e-72	77	316	73	323
UKZ79391.1|CBM50	5.21e-65	77	361	110	406

PDB Hits     

ATCC64974_91660-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	6.42e-46	77	361	147	439	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AZ68|LYSM3_ARTBC	1.10e-14	85	224	268	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	7.24e-14	167	224	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	7.51e-13	95	227	39	184	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.67e-10	165	361	251	517	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002483	0.997489	CS pos: 17-18. Pr: 0.9264

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_91660-t41_1-p1.