CAZyme Information: ATCC64974_87570-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_87570-t41_1-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	OGUI01000016.1|CGC10	91917.68	7.8577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000016.1:231572-234477(-)

Full Sequence      

MEKDPRLGYSDPGSSSYDQAPPPYSPYNDSGPVVESADVQANGRVNVDLDSSLARTLASI
IELQQEDLQNPPPNYSEDQLIKDELLQCDIQLNIVIQIVGSRGDVQPFIALGTELQKFGH
RVRIATHDVFSDFVTQGGLEFYPIGGDPAELMAFMVKNPGLIPQISSLRAGEVQKKRAMV
NEMLHGCWKSCIEDDPVTKIPFTADAIIANPPSFAHVHCAQALSIPVHLMFTMPWTSTKA
FPHPLANLSSSEMNPNVANWVSYGVVEWLTWQGLGDVVNRWRASIDLEPVPTAEGPRLAE
TLKIPFTYCWSPALIPRPRDWPANIDVCGFFFRDPPSYEPPLELKEFLESGTTPIYIGFG
SIVIDDPQKLTEIILEAIARTGVRAIISRGWSKLGGVPSSNTYYIDDCPHEWLFRHVAAV
VHHGGAGTTACGLANGRPTTIVPFFGDQPFWGSMVARSGAGPRPIPYASLNAENLAEAIA
FSLRPTTAESARGIALKMQHESGVAAAVRSFHRHLPLDRMRCSLIPNQPAMWIHKRSKKS
LKLSKVAVQLLIDNGKLNAKELRCNTINPIHIENRRWDPVTGIISASTSTGSAMLKSTGE
MLYNPYKEYTSSRSPKPPISRTASALSTTTTSSSSRSLADFPETSRRPSDRIDTQTSINS
GPNNNALSTAGNMVGASLKGFGKFTGAYFKGVVVDIPYAAAEGFRQVPRLYGEEPKQYGT
VRDWKSGATMGGKNFVDGMTDGFKGLFTQPIKGAREEGALGAVKGFAKGTIGLATKVPSA
GIGLVAYPFQGIAKTIEAAVRSKTGKAILLARLRDGYAMTERAHMTEDEQQYLLRRFQAL
TDP

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	122	514	2e-52	0.9581151832460733

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.33e-82	92	514	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.02e-50	94	509	4	389	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	8.60e-25	94	242	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	3.98e-10	103	509	7	367	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	1.01e-08	682	796	2306	2413	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48301.1|GT1	0.0	1	843	1	843
BCS15859.1|GT1	0.0	1	840	1	840
BCS04269.1|GT1	0.0	1	840	1	840
CAP79869.1|GT1	0.0	20	837	18	837
BCS26658.1|GT1	0.0	19	840	23	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.07e-75	99	519	27	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.19e-75	99	519	47	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.71e-29	92	507	1	391	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.48e-28	92	507	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.64e-23	92	507	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	3.21e-134	78	523	179	618	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	5.50e-132	91	516	155	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	2.91e-77	92	518	1164	1612	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q9Y751|ATG26_KOMPG	1.65e-76	65	515	734	1178	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|Q4WID6|ATG26_ASPFU	3.89e-76	92	515	902	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_87570-t41_1-p1.