CAZyme Information: ATCC64974_86880-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_86880-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1138	OGUI01000016.1|CGC1	125313.96	6.1437

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000016.1:32681-36465(-)

Full Sequence      

MLKRRDLPRLLTFISCSLLILCQVSFAYPSLEQSACYCFPGESCWPNDSQWAEFNRTVGG
RLIATTPIGSVCHLNNPWVAYNASACETLRAYWDFPKTHYQTSSSIMAGFYANQSCDPFL
SPSSRCIIGTYVQYAVRAESAADIQKTLAFITAHRIRLIVRNTGHDYLGKSTGAGAVAIW
THHLKEIDFLDYQSPNYTGSAIKVGAGVQIFESNAAASQRGLTVVGGNCRTVGLAGGYTQ
GGGHGQLVSRFGLAADQVLEWEVVTAAGDLITATPYNDYADLYWALSGGGGGTYGVVVSM
TSRAYPEMRTATANLTIAPVSTGQQTAFYEVISAFFNSTLGPLLDARGAGVWLLTSAGFE
ATPLTIPGGTRAQLQAIVEPVLAALNRTSGVLYTYHIEEFPSFYSSFETMSPDENITEYN
LGGRFIPRQLLDREPQTFVDRFRRIAGSGAVISGISVNASHGNTHANSVNPAWRDAAIDV
VVGTPLSSTNTTLNIQNQRLITDVLLPQLEEITPRGGAYLNEADPHQPQWQKTFYGANYD
RLLQIKKKYDPEDIFYALTAVGSEPASNPDAVEETLPKPQEHLSNIAAAPTSHPTASVIP
EAAVPLQPDGSIETPHFDPLSEHNEQRLPSLDPAFPTSPVSLSQISLLNISPFEWYDLLA
RDAINHIQRLNDTSSGDPRWRFPEIALSRRQSPAPEHSGARSEQEARYYEQQRHALTHGD
GHTGSPLPNYHQLPQPWNTTSRLELSPTDLTFFQYYIEVVGPILDLFDPARHFSNVVPHL
ALRNTGLLKSVLAVGAKHMSLCLRHRGDGDAADGHAAGTPASLPATVVSTESDSAPTHMA
TQYYYETLHYLSQTLLYPSYADSHEILATATMISTYEMFDADSAANSSVWEQHLRGSFWI
QRSQDNDGESADGLRQAVWWAWLRQDIWAAFQAGRPTITFWRARKPLEELSSDELATRIV
YLCGKCVKYAASAAIPPHQDPRERIEQGDRLLSALDEWYRILPASYQPVTVAEGAGSSAV
FPPIWIHPRNHAGAMQMYHFAKATVLLNQPTLGGLNAYLLRDKQLTESVKTVCGIANSCQ
EHDCAMAFINVQALFGVGQFVRSPEMREELLRMLNNMLRISKFPAKGLVARLQRVWQE

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	136	322	1e-40	0.38427947598253276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.05e-16	133	274	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.28e-13	518	557	1	40	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
403235	Fungal_trans_2	2.07e-11	752	1138	2	360	Fungal specific transcription factor domain. This family of are likely to be transcription factors. This protein is found in fungi. Proteins in this family are typically between 454 to 826 amino acids in length. This protein is found associated with pfam00172.
223354	GlcD	5.37e-08	136	275	36	171	FAD/FMN-containing dehydrogenase [Energy production and conversion].
213391	fungal_TF_MHR	0.001	752	1135	9	405	fungal transcription factor regulatory middle homology region. This domain is present in the large family of fungal zinc cluster transcription factors that contain an N-terminal GAL4-like C6 zinc binuclear cluster DNA-binding domain. Examples of members of this large fungal group are the following Saccharomyces cerevisiae transcription factors, GAL4, STB5, DAL81, CAT8, RDR1, HAL9, PUT3, PPR1, ASG1, RSF2, PIP2, as well as the C-terminal domain of the Cep3, a subunit of the yeast centromere-binding factor 3. It has been suggested that this region plays a regulatory role.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	3.27e-60	35	564	499	1052
QKD57322.1|CBM91|GH43_11	3.27e-60	35	564	499	1052
CAE7214923.1|AA7	7.66e-15	130	563	62	491
EGX49222.1|AA7|CBM1	9.25e-13	139	556	171	587
QRW06655.1|AA7	2.53e-12	136	599	72	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.83e-113	35	564	27	561	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	7.61e-63	36	564	30	585	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	7.33e-15	140	555	56	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	2.99e-14	140	555	56	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6JQH_A	5.57e-13	141	431	63	339	Chain A, MaDA [Morus alba],6JQH_B Chain B, MaDA [Morus alba]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G0R6T3|SORD_HYPJQ	6.91e-162	32	564	35	560	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A075TR33|PATO_PENEN	2.43e-143	19	564	10	554	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	8.28e-142	24	564	18	550	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	1.75e-138	25	563	21	554	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	1.46e-112	35	564	27	561	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999685	CS pos: 27-28. Pr: 0.9797

TMHMM  Annotations     

Start	End
7	29