CAZyme Information: ATCC64974_85970-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_85970-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923	OGUI01000015.1|CGC3	103316.88	5.7050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000015.1:279225-281996(+)

Full Sequence      

MASQIFIETPTVEQHLTGFGIGTATPRLSWRFLTTDSSPRDWEQTAYEVQLTRSGSSAKT
YYVKSNASVLVPWPSDPLQSREIAQVRVRAYGCRAGEEQQAEGATSWSPWRVIECGLLDH
TDWVARTIANPEEPQPEAPLRPVRFRKEFQLPAASSVDKARLYITSFGVYRAFVNGHRVG
DQCLAPGWTSYRHRLNYQVFDVGPLLNAGGLNVLAVEVAEGWYATRLGFLGGRRQLYGDR
LAVLAQVEIQLGPKGDRFSMCTDSTWICTPSAIVRSELYDGEAYDAREEDPTWNCARLDQ
ASSWVAVREIDFPTAALVAPDAPPVRITEEIPPVSVQKTPSGATVIDFGQNLVGRLRVRS
LQKPSGSRVSFIHAEVLENGELGVRPLRHAKCTDEVILNGTELVDWSPQYTFHGFRYVQV
NGWDEEIDGSLLLNIKALVMHTDMTRSGWFSCSHPMINQLHTNAWWSMRGNFLSIPTDCP
QRDERLGWTGDIQVFCPSANFLYNTAGMLSDWLQDVAAEQLREKDGCVPPFTVPNVISET
LWPHTPQAVWDDVVILTPWALYRSYGDQDILRRQYESMLAWIDRGIRRGSDGLWDPELWQ
LGDWLDPTAPPEEPGDARTSGTLVADAYLVHITSVMSEVSQVLGQSQNAARFQADYDRLK
ASFQAKYITATGLLVGDTQTALSLAIVYDLHSTPEAAQAAASRLVHLVRLAKFRVATGFA
GTPIITHALTKSGYPQIAYRMLLEKNRPSWMYPITMGATTMWERWDSMLPDGTINPGEMT
SFNHYALGSIINWLHSTVAGVSPLSPGWKQIQVAPTPGPTIHSAEAMYDTPYGRLECRWS
IEIDADLFHMDLLIPPNSRARVVLPTPKKLSQPAGSREDGDDLWVGSGHHHFSAPFEWRK
YTREWPPKPLIPIMRKPEPEDIA

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	336	864	7.7e-166	0.998015873015873
CBM67	128	313	8.1e-31	0.9488636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.19e-157	446	798	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	3.62e-67	157	329	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	5.79e-32	337	441	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	4.39e-22	800	869	1	68	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38995.1|GH78	0.0	1	923	1	923
BCS09327.1|GH78	0.0	1	923	1	922
BCR96839.1|GH78	0.0	1	923	1	922
BAE58123.1|GH78	0.0	1	923	1	923
QRD82895.1|GH78	0.0	1	923	1	923

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.69e-275	13	892	10	863	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.63e-157	118	894	273	1030	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	8.58e-109	20	892	45	939	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	6.06e-157	118	894	273	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	9.97e-140	65	866	98	880	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	1.53e-128	13	892	38	908	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	8.33e-71	63	864	93	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000014

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_85970-t41_1-p1.