CAZyme Information: ATCC64974_85800-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_85800-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	OGUI01000015.1|CGC4	53762.17	4.7290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000015.1:230254-231827(+)

Full Sequence      

MAAGEQFEYIIVGGGTAGCVLASRLKQYNSSLSILLVEAGPDASNHPLVPDGSKATQLLG
SELDWTYDTVPQKHLHDSVLSNHAGKALGGSTTINSGGWMRGAKEDYDLWASLVGDFRWS
YHGLLPYFRKLEHHFDPFADPEVHGFEGPIKTESVSSTGRRYPLRQLVQEVWNSVGVAYN
SNINSGSPYGLVEVVENRDHGMRQMSSSVYPLDVEVMTETLVKRVLVEERDDQKVAIGVV
LEDTDESQIIARQEVIISAGAYRTPQLMMLSGIGPAEELRAYGIDIVLDLPDVGRHFADH
VAVSQWWQLKHPEKGLSIGSPAFTDPAFFRGNPIDFVALDSVPLDGLRQALVKDDPNSNP
DEHPLIASQRVHVETFTVYAAGNAQNPTIATDGTHITTGVSCMLPTSRGSIKLADRDVRS
APRIDPNYCATEADRYVLREGLRKLRKALRDTSAGQEMIESETVEENYDPLGPETDDEAL
DDLIRRRAA

Enzyme Prediction     

No EC number prediction in ATCC64974_85800-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	487	3.1e-115	0.8767605633802817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.92e-65	1	488	2	469	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.43e-63	5	488	4	468	choline dehydrogenase; Validated
366272	GMC_oxred_N	2.12e-27	84	302	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.76e-23	5	450	54	469	Protein HOTHEAD
398739	GMC_oxred_C	4.25e-11	405	488	1	83	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38976.1|AA3_2	0.0	1	489	1	489
BCR96857.1|AA3_2	0.0	1	489	1	489
BCS09345.1|AA3_2	0.0	1	489	1	489
QKX53281.1|AA3_2	6.76e-189	7	487	3	478
QKX57982.1|AA3_2	1.89e-182	5	487	4	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	4.25e-50	1	485	35	529	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	6.84e-47	4	462	4	484	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	6.84e-47	4	462	4	484	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.84e-47	4	462	4	484	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
6YS1_AAA	3.65e-42	3	486	4	493	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	1.06e-89	5	485	3	456	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q3L243|PDH2_LEUMG	1.11e-49	1	488	35	530	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|Q3L245|PDH1_LEUMG	2.19e-49	1	485	35	529	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	5.60e-49	6	488	40	530	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|V5NC32|PDH1_AGAXA	1.07e-48	6	488	40	530	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999967	0.000073

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_85800-t41_1-p1.