CAZyme Information: ATCC64974_84500-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_84500-t41_1-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	OGUI01000014.1|CGC4	42443.73	6.3085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000014.1:610184-611489(-)

Full Sequence      

MIRGKSRFTKYIVAAFASYIILTLLFSGTGGKYWKQDWVRIARSTLEDRALEHIQNETLG
FEHIYAIGLKERTDKRDFLNLAASIAGFRVEWIDGVHPEDMSEKALLNDNLLAPSEIGCW
RAHMNALSNMVQNSYSTALILEDDADWDVNIRQQLREFARGVRALTRNANTTKSAPYGTN
WDILWVGGCASSAAPNETQFYAIPHDPTAPSVDHRGTWGGPLDSWKENYPETSTRFIYRA
DMGCCTYGYAVTKRGAERILAALAVDRLVAAVDNSMADMCGGKDGRSQIECYAPFPNIIG
TYKAAGLASKDSDIREGSDEWHEAQAWNLMYSTRLNIHRLVAGRDTVYAQYDEGFPWSRR
VLNWKEFEYPRGYLVS

Enzyme Prediction     

No EC number prediction in ATCC64974_84500-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	61	276	2.8e-34	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	9.40e-19	63	150	1	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	1.66e-09	60	298	1	206	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
366794	Glyco_transf_25	1.11e-06	61	276	1	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38229.1|GT25	1.64e-283	1	376	313	688
BCS10899.1|GT25	2.42e-281	1	376	1	376
BCR98565.1|GT25	1.18e-280	1	376	43	418
CAP93867.1|GT25	9.99e-165	5	373	11	382
CAP98036.1|GT25	1.37e-158	1	376	1	389

PDB Hits     

ATCC64974_84500-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8K297|GT251_MOUSE	2.36e-06	56	262	330	507	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|A5PK45|GT251_BOVIN	9.69e-06	57	269	337	520	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996025	0.004007

TMHMM  Annotations     

Start	End
12	34