CAZyme Information: ATCC64974_84480-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_84480-t41_1-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	OGUI01000014.1|CGC6	42816.39	6.2915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000014.1:606217-607387(-)

Full Sequence      

MILQSSSRGSCLQWLTSHFNRRRFQLSFALAIVLLLSYLFHLDVLPTNYETPFKDHYART
LSARDLLARPLSQDLTTIPKLIHQTWFPAGSNMSDDAQTWVRTMRSQNADWEYVLWDDET
NRMLVEQYFPWFLTDYNRLPKEIHRADVVRNLYMYLFGGMYADVDTEALRPVEPLFTSHF
TTLARHNQILSSGPRKIDHDCTQRGFVGHMAHKEGLDGPAAVPNGWMASPPGHPFWLLPV
IHVIENPNGNGDGSVESLTGPGALGTMLHKYYEDFKDSSVRTHVCRTVRRWSPAWDLYCG
PEGSEEEVGAKVDKMVVLPRQQIYPYSWADDKHPACLAAWGNPDFNPDECKRWIDVDEWP
SYFITYCTHSW

Enzyme Prediction     

No EC number prediction in ATCC64974_84480-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	98	176	3.6e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.13e-20	76	281	80	249	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.28e-14	94	175	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10897.1|GT32	1.20e-283	1	371	1	371
BCR98563.1|GT32	1.20e-283	1	371	1	371
CAK38227.1|GT32	1.50e-202	93	349	1	257
QRD92713.1|GT32	5.38e-160	20	371	11	362
QMW36295.1|GT32	5.38e-160	20	371	11	362

PDB Hits     

ATCC64974_84480-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	9.93e-19	72	175	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.49e-15	48	271	55	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	3.25e-13	74	248	60	203	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q5A4E3|OCH1_CANAL	3.10e-08	79	325	100	350	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000012

TMHMM  Annotations     

Start	End
26	45