CAZyme Information: ATCC64974_83240-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_83240-t41_1-p1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	OGUI01000014.1|CGC7	46391.81	7.2900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000014.1:265399-266814(-)

Full Sequence      

MAPTRLRRLAIVALIGAVLMICICQQRTQFDTRPLDLEDQYPLLYRHVHTQSTEGGAWYI
PPQWTNASKPPPKNIVEAAELALSAAQASPDGYLPHSTIPMIVHQTWKNTRIDTWPQIIR
HSAERWLQTTKGQMAYFLWTDEGMEQFIHHFEPDLESQYAHLARNVERSDVFRIVISKWI
GGVYGDIDTEPLRTPADWITPTDLHAWNDTRAGTSYNSTAPVRAIVGLEADCPEGSDTYW
RMGYSQPVQLTQWAFAWAPGHPILQKFIDRLSATIGDISDRYGGSLQSRAARQELMNLDP
LTLTGPAAFTDVVRSRLEEVAGLRWHALSGLKDGGKSKLVDDVLILPITGFSPGRGTYGN
MGSKPITDPSARLRHLAQGSWRAFDVKVEYGKFCRTVLGMCRDWSKVPTVVVQ

Enzyme Prediction     

No EC number prediction in ATCC64974_83240-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.85e-19	93	274	76	246	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.08e-07	136	199	20	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38082.1|GT32	0.0	1	413	1	413
BCR93027.1|GT32	1.53e-305	1	413	1	413
BCS05686.1|GT32	1.53e-305	1	413	1	413
ADK37855.1|GT32	3.15e-220	1	386	1	385
QKX57092.1|GT32	4.45e-173	5	406	10	414

PDB Hits     

ATCC64974_83240-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.03e-26	96	382	139	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.33e-23	100	382	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.53e-16	93	352	124	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.91e-16	93	382	90	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.563606	0.436406

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_83240-t41_1-p1.