CAZyme Information: ATCC64974_81690-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_81690-t41_1-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	OGUI01000013.1|CGC6	54675.22	6.0544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000013.1:2611860-2613299(+)

Full Sequence      

MWAKTADKPRSSMGKRKLLRFVVISCLVTSFTIFLWPRLESPRVTTETVSNITITSDVGC
EPDYEALRRLNVQKLTQYVRREVVASESPSNILPLSQHLQVPLFPQKSHGDQLHLPEELM
HEDCLIPHPVALQVPTPPRHADASHIDFGVATTIERLNDSLDAFSHWAGYTNAHIFALVE
PDERAHEVLLKADALGINLSISESSEEYQRRYFSLVPHLAKNMRPETRWSCVMDDDTFFL
SMPELVKGLKEYDDTKPMYVGGLSESIPQVGVFGLMGFGGAGVFLSRPLIQELSRPEVFE
DCQRMDVTGDRRISLCIYQYTDVRLTIDHRLHQLDMMGDVSGFFEAERQPPLSVHHWKSW
FHADMAKASAVTEICGDSCLLRKWHFGDGWILTNGFSVVKYSSEKKPGDRSMELTWDSHN
GAVFESYLHELGPLRLKDEGKISYLHEDAIIDGNRVRQWYVHRDPEKGDQILELIWRTA

Enzyme Prediction     

No EC number prediction in ATCC64974_81690-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.49e-12	225	356	209	341	hypothetical protein; Provisional
367085	Fringe	2.27e-11	195	360	51	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	6.03e-10	276	356	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96997.1|GT31	0.0	1	479	1	479
BCS09474.1|GT31	0.0	1	479	1	479
CAK44690.1|GT31	0.0	13	460	1	448
BAE58287.1|GT31	2.30e-252	1	478	1	484
UDD56605.1|GT31	2.30e-252	1	478	1	484

PDB Hits     

ATCC64974_81690-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ATCC64974_81690-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000006

TMHMM  Annotations     

Start	End
19	36