CAZyme Information: ATCC64974_80600-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_80600-t41_1-p1
• CAZy Family: GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		51752.46	9.0430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000013.1:2244605-2246137(-)

Full Sequence      

MSSSLSSPATSRPSLLNPRQPIKALTVAFCLWKALVYLVIISCPGLGYDTSTSHLYHSHS
RPDVTSEDITYAHLPIPLKFVRWDSVYFLHIAENGYIFEQEWAFGYGYTRVLAYIATALQ
RLIGPSGAARTAVVATALSHITHYLAVLALYRLSVNVFGRDTATQRLICFLSAVLHVICP
AGAFLSAPYGESLFSFLNITGFYVYSSSFLDSKAGKRLSGDVKLLVAAILFSAATAVRSN
GILSGILYAYDALLQLRRVWCQRLSIDACAHLSVIIISGCVIALGLVVPQVVAYSTYCVE
DDISRPWCQWLVPSIYRHVQGHYWNVGFLRYWTVSNIPLFILAMPMLAILCRSSLWALDV
AVPFIFPRALSGVDQASSSATTASLLLRLAVPQGLLALMALTSYHVQIINRISSGYPLWY
WYLVYLVSGNWGQMRPSLQDSRTFTVAVRGMVAYALIQAILFGSFLPPA

Enzyme Prediction     

No EC number prediction in ATCC64974_80600-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	27	469	2.3e-119	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	9.81e-41	22	469	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.09e-18	82	469	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38795.1|GT76	0.0	1	469	1	466
BCS01167.1|GT76	0.0	1	469	1	469
BCS12914.1|GT76	0.0	1	469	1	469
QMW40534.1|GT76	1.45e-197	9	469	6	452
QRD82967.1|GT76	1.45e-197	9	469	6	452

PDB Hits     

ATCC64974_80600-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	6.16e-190	9	469	6	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	8.44e-165	15	469	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.90e-79	21	469	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	4.69e-78	20	469	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.35e-43	79	469	45	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000021

TMHMM  Annotations     

Start	End
24	46
104	123
133	155
167	189
228	250
271	293
328	350
412	434
444	466