CAZyme Information: ATCC64974_78890-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_78890-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534	OGUI01000013.1|CGC16	56237.54	5.2236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000013.1:1670815-1672486(-)

Full Sequence      

MTHLSADYIVIGGGTAGLVVANRLSEDPDVQVLVLEAGPDRSSDERVQDPAAWPTLSGSE
MDWQFKTVPQPALNNRDQDYAAGRLLGGTSAINGLAFVPPAPAGIDAWEALGNPGWSWQS
LAPYFHRSFHICPQSTPGNGPGAAASAAAGPIEVTYPALAEPRNHTIIDAWNKSFADKGY
AFSDTLIPTPTIGTRPYTATITTTGVRSDSTQYAASRPNLRILADTTVERILFDTTTTTI
TATGVLLHNDPSPITATKEVILAAGAFNTPKLLELSGIGSASRLSTHDIPCIIDNPSVGE
NLQNHLMALLPVPIQASSDSASPTPGIQAISFVRSGAEADLLARHPPLQTPLNTLLANPS
EPTACFFLSTLPNSMAILGLIPSYPLSRGSVHLSSSQPTDKPIIDPDYLSHPLDLPLMAE
HFKTLHSLPTSLPLKELLGSAPGPSPETQDPGVVEETLRASVVAAHHFCGTAIMAPREKG
GVVDSNLRVYGTGNLRIVDASVFPIVTAANPMSTVYAVAERAAELIRGRAGHSV

Enzyme Prediction     

No EC number prediction in ATCC64974_78890-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	527	7e-149	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.03e-97	1	534	3	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.21e-90	1	530	1	535	choline dehydrogenase; Validated
398739	GMC_oxred_C	7.44e-41	385	522	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.37e-24	3	515	53	565	Protein HOTHEAD
366272	GMC_oxred_N	1.77e-21	71	306	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96464.1|AA3_2	0.0	1	534	1	534
BCS12736.1|AA3_2	0.0	1	529	4	531
BCS00980.1|AA3_2	3.80e-299	70	529	7	465
QRD83786.1|AA3_2	1.36e-151	6	527	4	530
QMW32332.1|AA3_2	1.36e-151	6	527	4	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.12e-75	1	527	1	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	5.07e-60	7	527	3	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.22e-59	7	527	4	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.10e-54	3	527	3	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3LJP_A	1.24e-51	7	533	15	534	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	4.26e-71	5	528	46	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.26e-71	5	528	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	1.23e-70	1	526	9	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	2.17e-63	6	527	5	527	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P64264|Y1310_MYCBO	2.17e-63	6	527	5	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000047

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_78890-t41_1-p1.