CAZyme Information: ATCC64974_75710-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_75710-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		35648.98	4.0312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000013.1:613913-615238(+)

Full Sequence      

MVKSILASVFFAATALAASRMTAPSGAIVVAKSGGDYDTISAAVDALSTTSTETQTIFIE
EGSYDEQVYIPALSGKLIVYGQTEDTTTYTSNLVNITHAIALADVDNDDETATLRNYAEG
SAIYNLNIANTCGQACHQALAVSAYATEQGYYACQFTGYQDTLLAETGYQVYAGTYIEGA
VDFIFGQHARAWFHECDIRVLEGPSSASITANGRSSESDDSYYVIHKSTVAAADGNDVSS
GTYYLGRPWSQYARVCFQKTSMTDVINHLGWTEWSTSTPNTENVTFVEYGNTGAGSKGPR
ANFSSELTEPISISTLLGSDWEDWVDTSYIN

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	307	8.2e-79	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.85e-49	28	296	2	266	Pectinesterase.
178051	PLN02432	1.10e-40	28	309	13	274	putative pectinesterase
215179	PLN02314	4.13e-40	24	321	276	574	pectinesterase
178346	PLN02745	6.73e-40	16	297	275	552	Putative pectinesterase/pectinesterase inhibitor
178106	PLN02488	3.35e-38	28	330	199	503	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38387.1|CE8	8.18e-239	1	331	1	331
BCS12403.1|CE8	1.07e-234	1	331	1	331
BCS00638.1|CE8	3.79e-234	1	331	35	365
CAA02202.1|CE8|3.1.1.11	4.35e-234	1	331	1	331
CAA02198.1|CE8|3.1.1.11	4.35e-234	1	331	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.09e-71	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.95e-71	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	7.94e-33	28	295	10	272	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.06e-26	29	331	6	313	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	5.20e-12	34	295	45	365	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	7.72e-235	1	331	1	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.09e-172	1	329	1	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	1.24e-70	19	329	30	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	6.40e-70	19	329	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	6.40e-70	19	329	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000398	0.999577	CS pos: 17-18. Pr: 0.9722

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_75710-t41_1-p1.