CAZyme Information: ATCC64974_71860-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ATCC64974_71860-t41_1-p1
• CAZy Family: GH67
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	OGUI01000011.1|CGC4	37302.61	7.0093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerN402ATCC64974	11187	N/A	0	11187

• Gene Location: location=OGUI01000011.1:121006-122037(+)

Full Sequence      

MADGMARVAIYQGRLYVLRALAKGEDHRRKILGILASIHRALVSAPQLAVILNTEIIFSV
EDKLEDVAGPDHPLWVLARKATEESVWLMPDFGFWSWGHIDTQIGPYDEVVKHVEEHEHP
WDEKENKLVWRGKLSFAPKLRRALLEIARNYAWADVKEVEWKNKANYLSMDNHCDYRFIA
HVEGRSYSASLKYRQACRSVIVIHELQYIQHHHYLLVSSGPQQNFVQVERDWTDLPHKIQ
ELLDNPIKARMIADNNVDVFRERYLTPAADACYWRALLQGWTTASPQITETMSDPTNVSN
KGIRYESFLLLDPSNMMRFRP

Enzyme Prediction     

No EC number prediction in ATCC64974_71860-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	55	282	2.3e-18	0.956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	1.19e-16	88	279	122	317	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.30e-14	88	281	46	249	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35140.1|GT0	4.08e-218	1	319	135	453
QRD91520.1|GT0	4.08e-218	1	319	135	453
QMW31874.1|GT0	2.16e-156	1	319	135	454
QRD90937.1|GT0	2.16e-156	1	319	135	454
UDD60835.1|GT0	8.72e-156	1	319	135	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.87e-06	42	279	125	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	1.29e-07	73	279	162	383	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.29e-06	76	279	164	382	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	7.19e-06	76	279	164	380	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q8T045|RUMI_DROME	9.77e-06	42	279	137	385	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ATCC64974_71860-t41_1-p1.